Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FOXM1 blocking peptide

FOXM1 Peptide - N-terminal region

Gene Names
FOXM1; MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Synonyms
FOXM1; FOXM1 Peptide - N-terminal region; FOXM1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Sequence Length
801
Applicable Applications for FOXM1 blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FOXM1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-FOXM1 Antibody, made

Target Description: This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Product Categories/Family for FOXM1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
forkhead box protein M1 isoform 1
NCBI Official Synonym Full Names
forkhead box M1
NCBI Official Symbol
FOXM1
NCBI Official Synonym Symbols
MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
NCBI Protein Information
forkhead box protein M1
UniProt Protein Name
Forkhead box protein M1
Protein Family
UniProt Gene Name
FOXM1
UniProt Synonym Gene Names
FKHL16; HFH11; MPP2; WIN; HFH-11; HNF-3/fork-head homolog 11
UniProt Entry Name
FOXM1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

Uniprot Description

FOXM1: a transcriptional activator factor. Contains 1 fork-head domain. May play a role in the control of cell proliferation. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Phosphorylated in M (mitotic) phase. Three splice variant isoforms have been described. Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; DNA binding; sequence-specific DNA binding; transcription factor activity; protein kinase binding

Biological Process: transcription from RNA polymerase II promoter; regulation of Ras protein signal transduction; regulation of cell cycle; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; DNA repair; negative regulation of stress-activated MAPK cascade; liver development; cell cycle; regulation of cell proliferation; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; regulation of cell growth; negative regulation of transcription, DNA-dependent; G2/M transition of mitotic cell cycle; vasculogenesis

Research Articles on FOXM1

Similar Products

Product Notes

The FOXM1 foxm1 (Catalog #AAA3225163) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FOXM1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXM1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the FOXM1 foxm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LKRRRLPLPV QNAPSETSEE EPKRSPAQQE SNQAEASKEV AESNSCKFPA. It is sometimes possible for the material contained within the vial of "FOXM1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.