Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FBXO45 blocking peptide

FBXO45 Peptide - middle region

Gene Names
FBXO45; Fbx45
Reactivity
Human
Applications
Western Blot
Synonyms
FBXO45; FBXO45 Peptide - middle region; FBXO45 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
IRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHA
Sequence Length
286
Applicable Applications for FBXO45 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FBXO45 blocking peptide
This is a synthetic peptide designed for use in combination with anti-FBXO45 Antibody, made

Target Description: Members of the F-box protein family, such as FBXO45, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
Product Categories/Family for FBXO45 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
F-box/SPRY domain-containing protein 1
NCBI Official Synonym Full Names
F-box protein 45
NCBI Official Symbol
FBXO45
NCBI Official Synonym Symbols
Fbx45
NCBI Protein Information
F-box/SPRY domain-containing protein 1
UniProt Protein Name
F-box/SPRY domain-containing protein 1
UniProt Gene Name
FBXO45
UniProt Synonym Gene Names
FBX45; hFbxo45
UniProt Entry Name
FBSP1_HUMAN

NCBI Description

Members of the F-box protein family, such as FBXO45, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (summary by Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Jan 2011]

Uniprot Description

FBXO45: Component of E3 ubiquitin ligase complexes. Required for normal neuromuscular synaptogenesis, axon pathfinding and neuronal migration. Plays a role in the regulation of neurotransmission at mature neurons. May controls synaptic activity by controlling UNC13A via ubiquitin dependent pathway. Specifically recognizes TP73, promoting its ubiquitination and degradation. Belongs to the FBXO45/Fsn family.

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: presynaptic membrane; postsynaptic membrane; postsynaptic density; cell junction

Molecular Function: protein binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; anterior commissure morphogenesis; cerebral cortex tangential migration; protein ubiquitination during ubiquitin-dependent protein catabolic process; neuron migration; protein ubiquitination; cerebral cortex radially oriented cell migration; corticospinal tract morphogenesis; response to DNA damage stimulus

Research Articles on FBXO45

Similar Products

Product Notes

The FBXO45 fbxo45 (Catalog #AAA3242142) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FBXO45 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO45 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBXO45 fbxo45 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IRAFQHAFST NDCSRNVYIK KNGFTLHRNP IAQSTDGART KIGFSEGRHA. It is sometimes possible for the material contained within the vial of "FBXO45, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.