Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ERCC3 blocking peptide

ERCC3 Peptide - N-terminal region

Gene Names
ERCC3; XPB; BTF2; TTD2; GTF2H; RAD25; TFIIH
Reactivity
Human
Applications
Western Blot
Synonyms
ERCC3; ERCC3 Peptide - N-terminal region; ERCC3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Sequence Length
782
Applicable Applications for ERCC3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ERCC3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ERCC3 Antibody, made

Target Description: ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
Product Categories/Family for ERCC3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
general transcription and DNA repair factor IIH helicase subunit XPB isoform a
NCBI Official Synonym Full Names
ERCC excision repair 3, TFIIH core complex helicase subunit
NCBI Official Symbol
ERCC3
NCBI Official Synonym Symbols
XPB; BTF2; TTD2; GTF2H; RAD25; TFIIH
NCBI Protein Information
general transcription and DNA repair factor IIH helicase subunit XPB
UniProt Protein Name
TFIIH basal transcription factor complex helicase XPB subunit
UniProt Gene Name
ERCC3
UniProt Synonym Gene Names
XPB; XPBC; BTF2 p89; TFIIH 89 kDa subunit; TFIIH p89
UniProt Entry Name
ERCC3_HUMAN

NCBI Description

This gene encodes an ATP-dependent DNA helicase that functions in nucleotide excision repair. The encoded protein is a subunit of basal transcription factor 2 (TFIIH) and, therefore, also functions in class II transcription. Mutations in this gene are associated with Xeroderma pigmentosum B, Cockayne's syndrome, and trichothiodystrophy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

XPB: ATP-dependent 3'-5' DNA helicase, component of the core- TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage. One of the 6 subunits forming the core-TFIIH basal transcription factor which associates with the CAK complex composed of CDK7, CCNH/cyclin H and MNAT1 to form the TFIIH basal transcription factor. Interacts with PUF60. Interacts with ATF7IP. Interacts with Epstein-Barr virus EBNA2. Belongs to the helicase family. RAD25/XPB subfamily.

Protein type: Helicase; DNA repair, damage; EC 3.6.4.12; Transcription factor

Chromosomal Location of Human Ortholog: 2q21

Cellular Component: nucleoplasm; holo TFIIH complex; nucleus

Molecular Function: protein C-terminus binding; DNA-dependent ATPase activity; GTP binding; ATPase activity; dATP binding; 3'-5' DNA helicase activity; protein N-terminus binding; peptide binding; transcription factor binding; protein kinase activity; ATP-dependent DNA helicase activity; RNA polymerase subunit kinase activity; protein binding; DNA binding; damaged DNA binding; ATP binding

Biological Process: transcription from RNA polymerase II promoter; DNA topological change; viral reproduction; apoptosis; positive regulation of apoptosis; positive regulation of viral transcription; protein amino acid phosphorylation; regulation of gene expression, epigenetic; protein localization; mRNA capping; UV protection; negative regulation of gene expression, epigenetic; transcription-coupled nucleotide-excision repair; nucleotide-excision repair, DNA damage removal; response to UV; transcription initiation from RNA polymerase II promoter; hair cell differentiation; nucleotide-excision repair, DNA incision; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; termination of RNA polymerase I transcription; DNA repair; nucleotide-excision repair, DNA duplex unwinding; nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; response to hypoxia; gene expression; positive regulation of transcription from RNA polymerase II promoter; response to oxidative stress; transcription initiation from RNA polymerase I promoter

Disease: Trichothiodystrophy 2, Photosensitive; Xeroderma Pigmentosum, Complementation Group B

Research Articles on ERCC3

Similar Products

Product Notes

The ERCC3 ercc3 (Catalog #AAA3228795) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ERCC3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERCC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERCC3 ercc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGKRDRADRD KKKSRKRHYE DEEDDEEDAP GNDPQEAVPS AAGKQVDESG. It is sometimes possible for the material contained within the vial of "ERCC3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.