Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ENTPD3 blocking peptide

ENTPD3 Peptide - C-terminal region

Gene Names
MON1B; SRG1; HSRG1; SAND2
Reactivity
Human
Applications
Western Blot
Synonyms
ENTPD3; ENTPD3 Peptide - C-terminal region; ENTPD3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVIT
Sequence Length
529
Applicable Applications for ENTPD3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ENTPD3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ENTPD3 Antibody, made

Target Description: ENTPD3 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD3 contains 4 apyrase-conserved regions which is characteristic of NTPases.
Product Categories/Family for ENTPD3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
vacuolar fusion protein MON1 homolog B isoform 1
NCBI Official Synonym Full Names
MON1 homolog B, secretory trafficking associated
NCBI Official Symbol
MON1B
NCBI Official Synonym Symbols
SRG1; HSRG1; SAND2
NCBI Protein Information
vacuolar fusion protein MON1 homolog B
UniProt Protein Name
Vacuolar fusion protein MON1 homolog B
UniProt Gene Name
MON1B
UniProt Synonym Gene Names
HSRG1; KIAA0872; SAND2
UniProt Entry Name
MON1B_HUMAN

Research Articles on ENTPD3

Similar Products

Product Notes

The ENTPD3 mon1b (Catalog #AAA3240535) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ENTPD3 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENTPD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENTPD3 mon1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLQNSPTKNH LTNPCYPRDY SISFTMGHVF DSLCTVDQRP ESYNPNDVIT. It is sometimes possible for the material contained within the vial of "ENTPD3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.