DYNC1LI1 blocking peptide
DYNC1LI1 Peptide - middle region
Gene Names
DYNC1LI1; LIC1; DLC-A; DNCLI1
Reactivity
Human
Synonyms
DYNC1LI1; DYNC1LI1 Peptide - middle region; DYNC1LI1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLP
Sequence Length
523
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DYNC1LI1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- DYNC1LI1 Antibody, made
Target Description: The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking.
Target Description: The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking.
Product Categories/Family for DYNC1LI1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
cytoplasmic dynein 1 light intermediate chain 1 isoform 1
NCBI Official Synonym Full Names
dynein cytoplasmic 1 light intermediate chain 1
NCBI Official Symbol
DYNC1LI1
NCBI Official Synonym Symbols
LIC1; DLC-A; DNCLI1
NCBI Protein Information
cytoplasmic dynein 1 light intermediate chain 1
UniProt Protein Name
Cytoplasmic dynein 1 light intermediate chain 1
Protein Family
UniProt Gene Name
DYNC1LI1
UniProt Synonym Gene Names
DNCLI1; LIC1; DLC-A
UniProt Entry Name
DC1L1_HUMAN
NCBI Description
The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking. [provided by RefSeq, Jul 2016]
Research Articles on DYNC1LI1
1. conserved mechanism of effector interaction with dynein-dynactin necessary for processive motility
Similar Products
Product Notes
The DYNC1LI1 dync1li1 (Catalog #AAA3246687) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DYNC1LI1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIPPEEMKQM EQKLIRDFQE YVEPGEDFPA SPQRRNTASQ EDKDDSVVLP. It is sometimes possible for the material contained within the vial of "DYNC1LI1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
