Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNM1L blocking peptide

DNM1L Peptide - N-terminal region

Gene Names
DNM1L; DLP1; DRP1; DVLP; EMPF; OPA5; EMPF1; DYMPLE; HDYNIV
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Synonyms
DNM1L; DNM1L Peptide - N-terminal region; DNM1L blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG
Sequence Length
736
Applicable Applications for DNM1L blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DNM1L blocking peptide
This is a synthetic peptide designed for use in combination with anti-DNM1L Antibody, made

Target Description: The protein encoded by this gene is a member of the dynamin superfamily of GTPases. Members of the dynamin-related subfamily, including the S. cerevisiae proteins Dnm1 and Vps1, contain the N-terminal tripartite GTPase domain but do not have the pleckstrin homology or proline-rich domains. This protein establishes mitochondrial morphology through a role in distributing mitochondrial tubules throughout the cytoplasm. The gene has 3 alternatively spliced transcripts encoding different isoforms. These transcripts are alternatively polyadenylated.
Product Categories/Family for DNM1L blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
dynamin-1-like protein isoform 1
NCBI Official Synonym Full Names
dynamin 1 like
NCBI Official Symbol
DNM1L
NCBI Official Synonym Symbols
DLP1; DRP1; DVLP; EMPF; OPA5; EMPF1; DYMPLE; HDYNIV
NCBI Protein Information
dynamin-1-like protein
UniProt Protein Name
Dynamin-1-like protein
Protein Family
UniProt Gene Name
DNM1L
UniProt Synonym Gene Names
DLP1; DRP1; DVLP; Dymple; HdynIV
UniProt Entry Name
DNM1L_HUMAN

NCBI Description

This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]

Uniprot Description

DRP1: Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into ring-like structures which wrap around the scission site to constict and sever the mitochondrial membrane through a GTP hydrolysis- dependent mechanism. Required for normal brain development. Facilitates developmentally-regulated apoptosis during neural tube development. Required for a normal rate of cytochrome c release and caspase activation during apoptosis. Also required for mitochondrial fission during mitosis. May be involved in vesicle transport. Homotetramer; dimerizes through the N-terminal GTP-middle region of one molecule binding to the GED domain of another DNM1L molecule. Can self-assemble in multimeric ring-like structures. Interacts with BCL2L1; the interaction stimulates the GTPase activity of DMN1L in synapses and increases the number of axonal mitochondria and the size and number of synaptic vesicle clusters. Interacts with FIS1. Interacts with GSK3B and MARCH5. Interacts (via the GTPase and B domains) with UBE2I; the interaction promotes sumoylation of DNM1L, mainly in ite B domain. Interacts with PPP3CA; the interaction dephosphorylates DNM1L and regulates its transition to mitochondria. Interacts witn MID49 and MID51. Ubiquitously expressed with highest levels found in skeletal muscles, heart, kidney and brain. Isoform 1 is brain-specific. Isoform 2 and isoform 3 are predominantly expressed in testis and skeletal muscles respectively. Isoform 4 is weakly expressed in brain, heart and kidney. Isoform 5 is dominantly expressed in liver, heart and kidney. Isoform 6 is expressed in neurons. Belongs to the dynamin family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Microtubule-binding; Motor; EC 3.6.5.5; Endoplasmic reticulum; Hydrolase; Apoptosis

Chromosomal Location of Human Ortholog: 12p11.21

Cellular Component: Golgi apparatus; microtubule; protein complex; intracellular membrane-bound organelle; mitochondrion; synaptic vesicle membrane; coated pit; cytosol; mitochondrial outer membrane; membrane; perinuclear region of cytoplasm; cytoplasm; peroxisome; cell junction

Molecular Function: GTPase activity; identical protein binding; protein binding; protein homodimerization activity; GTP binding; ubiquitin protein ligase binding; lipid binding

Biological Process: peroxisome fission; mitochondrial fission; release of cytochrome c from mitochondria; positive regulation of protein secretion; apoptosis; metabolic process; positive regulation of apoptosis; regulation of protein oligomerization; endocytosis; mitochondrial fragmentation during apoptosis; cell structure disassembly during apoptosis; protein homotetramerization

Disease: Encephalopathy, Lethal, Due To Defective Mitochondrial And Peroxisomal Fission

Research Articles on DNM1L

Similar Products

Product Notes

The DNM1L dnm1l (Catalog #AAA3235692) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DNM1L Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNM1L can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the DNM1L dnm1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IRQEIENETE RISGNNKGVS PEPIHLKIFS PNVVNLTLVD LPGMTKVPVG. It is sometimes possible for the material contained within the vial of "DNM1L, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.