DKFZp686P1551 blocking peptide
DKFZp686P1551 Peptide - C-terminal region
Gene Names
EXOC7; BLOM4; EX070; EXO70; EXOC1; 2-5-3p; Exo70p; YJL085W
Reactivity
Human
Applications
Western Blot
Synonyms
DKFZp686P1551; DKFZp686P1551 Peptide - C-terminal region; DKFZp686P1551 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK
Sequence Length
573
Applicable Applications for DKFZp686P1551 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DKFZp686P1551 blocking peptide
The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.
Product Categories/Family for DKFZp686P1551 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
63kDa
NCBI Official Full Name
Hypothetical protein DKFZp686P1551
NCBI Official Synonym Full Names
exocyst complex component 7
NCBI Official Symbol
EXOC7
NCBI Official Synonym Symbols
BLOM4; EX070; EXO70; EXOC1; 2-5-3p; Exo70p; YJL085W
NCBI Protein Information
exocyst complex component 7
NCBI Description
The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Nov 2011]
Research Articles on DKFZp686P1551
Similar Products
Product Notes
The DKFZp686P1551 (Catalog #AAA3236614) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DKFZp686P1551 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DKFZp686P1551 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DKFZp686P1551 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLHNNYNYIL KSLEKSELIQ LVAVTQKTAE RSYREHIEQQ IQTYQRSWLK. It is sometimes possible for the material contained within the vial of "DKFZp686P1551, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
