Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DHX38 blocking peptide

DHX38 Peptide - middle region

Gene Names
DHX38; RP84; DDX38; PRP16; PRPF16
Reactivity
Human
Applications
Western Blot
Synonyms
DHX38; DHX38 Peptide - middle region; DHX38 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
HKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSE
Sequence Length
1227
Applicable Applications for DHX38 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DHX38 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DHX38 Antibody, made

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process.
Product Categories/Family for DHX38 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140kDa
NCBI Official Full Name
pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
NCBI Official Synonym Full Names
DEAH-box helicase 38
NCBI Official Symbol
DHX38
NCBI Official Synonym Symbols
RP84; DDX38; PRP16; PRPF16
NCBI Protein Information
pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
UniProt Protein Name
Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
UniProt Gene Name
DHX38
UniProt Synonym Gene Names
DDX38; KIAA0224; PRP16
UniProt Entry Name
PRP16_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process. [provided by RefSeq, Jul 2008]

Uniprot Description

DHX38: Probable ATP-binding RNA helicase involved in pre-mRNA splicing. Belongs to the DEAD box helicase family. DEAH subfamily. PRP16 sub-subfamily.

Protein type: Spliceosome; EC 3.6.4.13; RNA-binding; RNA processing; Helicase; RNA splicing

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus

Molecular Function: protein binding; ATP-dependent RNA helicase activity; ATP binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; RNA splicing; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription

Research Articles on DHX38

Similar Products

Product Notes

The DHX38 dhx38 (Catalog #AAA3228098) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DHX38 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHX38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DHX38 dhx38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HKHWELAGTK LGDIMGVKKE EEPDKAVTED GKVDYRTEQK FADHMKRKSE. It is sometimes possible for the material contained within the vial of "DHX38, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.