Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DERL2 blocking peptide

DERL2 Peptide - C-terminal region

Gene Names
DERL2; FLANa; F-LANa; CGI-101; F-LAN-1; derlin-2; DERtrin-2
Reactivity
Human
Synonyms
DERL2; DERL2 Peptide - C-terminal region; DERL2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFA
Sequence Length
239
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DERL2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- DERL2 Antibody, made

Target Description: Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL2 is involved in the degradation of misfolded glycoproteins in the ER.
Product Categories/Family for DERL2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
derlin-2 isoform c
NCBI Official Synonym Full Names
derlin 2
NCBI Official Symbol
DERL2
NCBI Official Synonym Symbols
FLANa; F-LANa; CGI-101; F-LAN-1; derlin-2; DERtrin-2
NCBI Protein Information
derlin-2
UniProt Protein Name
Derlin-2
Protein Family
UniProt Gene Name
DERL2
UniProt Synonym Gene Names
DER2; FLANA
UniProt Entry Name
DERL2_HUMAN

NCBI Description

Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL2 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).[supplied by OMIM, Mar 2008]

Uniprot Description

DERL2: Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal glycoproteins, but not that of misfolded nonglycoproteins. May act by forming a channel that allows the retrotranslocation of misfolded glycoproteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the degradation substrate. In contrast to DERL1, it is not involved in the degradation of MHC class I heavy chains following infection by cytomegaloviruses. May play a role in cell proliferation. Belongs to the derlin family.

Protein type: Endoplasmic reticulum; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; early endosome; late endosome; integral to endoplasmic reticulum membrane

Molecular Function: protein binding

Biological Process: retrograde protein transport, ER to cytosol; ER-associated protein catabolic process; suckling behavior; unfolded protein response; positive regulation of cell proliferation; positive regulation of cell growth

Research Articles on DERL2

Similar Products

Product Notes

The DERL2 derl2 (Catalog #AAA3247327) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DERL2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: IYFFLEDVFP NQPGGIRILK TPSILKAIFD TPDEDPNYNP LPEERPGGFA. It is sometimes possible for the material contained within the vial of "DERL2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.