Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DAB2 blocking peptide

DAB2 Peptide - N-terminal region

Gene Names
DAB2; DOC2; DOC-2
Reactivity
Human
Applications
Western Blot
Synonyms
DAB2; DAB2 Peptide - N-terminal region; DAB2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAK
Sequence Length
552
Applicable Applications for DAB2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DAB2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DAB2 Antibody, made

Target Description: This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains of GRB2, an adaptor protein that couples tyrosine kinase receptors to SOS (a guanine nucleotide exchange factor for Ras), via its C-terminal proline-rich sequences, and may thus modulate growth factor/Ras pathways by competing with SOS for binding to GRB2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for DAB2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
Disabled homolog 2
NCBI Official Synonym Full Names
DAB adaptor protein 2
NCBI Official Symbol
DAB2
NCBI Official Synonym Symbols
DOC2; DOC-2
NCBI Protein Information
disabled homolog 2
UniProt Protein Name
Disabled homolog 2
Protein Family
UniProt Gene Name
DAB2
UniProt Synonym Gene Names
DOC2
UniProt Entry Name
DAB2_HUMAN

NCBI Description

This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains of GRB2, an adaptor protein that couples tyrosine kinase receptors to SOS (a guanine nucleotide exchange factor for Ras), via its C-terminal proline-rich sequences, and may thus modulate growth factor/Ras pathways by competing with SOS for binding to GRB2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

DAB2: an adaptor protein that interacts with Grb2, myosin VI, SMAD2/3, DIP1/2, Dvl-3, the integrin betasubunit, and c-Src. Negatively regulates canonical Wnt signaling by stabilizing the beta-catenin degradation complex. A component of the CSF-1 signal transduction pathway. Phosphorylated DAB2 inhibits adhesion and integrin signaling. Two alternatively spliced isoforms are described.

Protein type: Adaptor/scaffold; Tumor suppressor

Chromosomal Location of Human Ortholog: 5p13.1

Cellular Component: focal adhesion; clathrin-coated vesicle; intracellular membrane-bound organelle; lysosomal membrane; apical plasma membrane; nucleolus; plasma membrane; clathrin coated vesicle membrane; coated pit; clathrin coat of coated pit

Molecular Function: protein C-terminus binding; integrin binding; protein binding; phosphatidylinositol-4,5-bisphosphate binding; SMAD binding

Biological Process: cellular morphogenesis during differentiation; pinocytosis; apoptosis; positive regulation of transcription, DNA-dependent; positive regulation of endocytosis; excretion; activation of JNK activity; clathrin cage assembly; protein transport; positive regulation of RNA elongation from RNA polymerase II promoter; negative regulation of protein binding; positive regulation of receptor recycling; integrin-mediated signaling pathway; receptor-mediated endocytosis; Wnt receptor signaling pathway; in utero embryonic development; leading edge cell differentiation; positive regulation of transforming growth factor beta receptor signaling pathway; cell proliferation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; myeloid cell differentiation; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent; positive regulation of cell migration; endoderm development; negative regulation of apoptosis

Research Articles on DAB2

Similar Products

Product Notes

The DAB2 dab2 (Catalog #AAA3231086) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DAB2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DAB2 dab2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVETSATNGQ PDQQAAPKAP SKKEKKKGPE KTDEYLLARF KGDGVKYKAK. It is sometimes possible for the material contained within the vial of "DAB2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.