Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CUX1 blocking peptide

CUX1 Peptide-C-terminal region

Gene Names
CUX1; CDP; CUX; p75; CASP; CDP1; COY1; Clox; p100; p110; p200; CUTL1; GOLIM6; CDP/Cut; Cux/CDP; Nbla10317
Reactivity
Human
Synonyms
CUX1; CUX1 Peptide-C-terminal region; CDP; CUX; p75; CASP; CDP1; COY1; Clox; p100; p110; p200; CUTL1; GOLIM6; CDP/Cut; Cux/CDP; Nbla10317; CUX1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
1483 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CUX1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CUX1 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
164,187 Da
NCBI Official Full Name
protein CASP isoform d
NCBI Official Synonym Full Names
cut-like homeobox 1
NCBI Official Symbol
CUX1
NCBI Official Synonym Symbols
CDP; CUX; p75; CASP; CDP1; COY1; Clox; p100; p110; p200; CUTL1; GOLIM6; CDP/Cut; Cux/CDP; Nbla10317
NCBI Protein Information
protein CASP; cut homolog; homeobox protein cux-1; CCAAT displacement protein; golgi integral membrane protein 6; putative protein product of Nbla10317
UniProt Protein Name
Homeobox protein cut-like 1
Protein Family
UniProt Gene Name
CUX1
UniProt Synonym Gene Names
CUTL1; CDP
UniProt Entry Name
CUX1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Feb 2011]

Uniprot Description

CUTL1: Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Belongs to the CUT homeobox family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: integral to Golgi membrane; nucleus; cytosol

Molecular Function: sequence-specific DNA binding; chromatin binding

Biological Process: regulation of transcription from RNA polymerase II promoter; intra-Golgi vesicle-mediated transport; transcription, DNA-dependent; multicellular organismal development; auditory receptor cell differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of dendrite morphogenesis; negative regulation of transcription from RNA polymerase II promoter; kidney development; lung development

Research Articles on CUX1

Similar Products

Product Notes

The CUX1 cux1 (Catalog #AAA3249295) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CUX1 Peptide-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: LQSLFGLPEA AGARDSRDNP LRKKKAANLN SIIHRLEKAA SREEPIEWEF. It is sometimes possible for the material contained within the vial of "CUX1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.