CUTA blocking peptide
CUTA Peptide - middle region
Gene Names
CUTA; ACHAP; C6orf82
Reactivity
Human
Applications
Western Blot
Synonyms
CUTA; CUTA Peptide - middle region; CUTA blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL
Sequence Length
179
Applicable Applications for CUTA blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CUTA blocking peptide
This is a synthetic peptide designed for use in combination with anti-CUTA Antibody, made
Target Description: CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
Target Description: CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
Product Categories/Family for CUTA blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
protein CutA isoform 3
NCBI Official Synonym Full Names
cutA divalent cation tolerance homolog
NCBI Official Symbol
CUTA
NCBI Official Synonym Symbols
ACHAP; C6orf82
NCBI Protein Information
protein CutA
UniProt Protein Name
Protein CutA
Protein Family
UniProt Gene Name
CUTA
UniProt Synonym Gene Names
ACHAP; C6orf82
UniProt Entry Name
CUTA_HUMAN
Uniprot Description
CUTA: May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE). Belongs to the CutA family. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 6p21.32
Cellular Component: membrane
Molecular Function: protein binding; enzyme binding
Biological Process: response to metal ion; protein localization
Research Articles on CUTA
Similar Products
Product Notes
The CUTA cuta (Catalog #AAA3232447) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CUTA Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CUTA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CUTA cuta for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AFVTCPNEKV AKEIARAVVE KRLAACVNLI PQITSIYEWK GKIEEDSEVL. It is sometimes possible for the material contained within the vial of "CUTA, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
