Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CSRNP2 blocking peptide

CSRNP2 Peptide - C-terminal region

Gene Names
CSRNP2; C12orf2; PPP1R72; TAIP-12; C12orf22; FAM130A1
Reactivity
Human
Applications
Western Blot
Synonyms
CSRNP2; CSRNP2 Peptide - C-terminal region; CSRNP2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA
Sequence Length
543
Applicable Applications for CSRNP2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CSRNP2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CSRNP2 Antibody, made

Target Description: The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for CSRNP2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
cysteine/serine-rich nuclear protein 2
NCBI Official Synonym Full Names
cysteine and serine rich nuclear protein 2
NCBI Official Symbol
CSRNP2
NCBI Official Synonym Symbols
C12orf2; PPP1R72; TAIP-12; C12orf22; FAM130A1
NCBI Protein Information
cysteine/serine-rich nuclear protein 2
UniProt Protein Name
Cysteine/serine-rich nuclear protein 2
UniProt Gene Name
CSRNP2
UniProt Synonym Gene Names
C12orf22; FAM130A1; TAIP12; CSRNP-2; TAIP-12
UniProt Entry Name
CSRN2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

TAIP12: Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. May play a role in apoptosis. Belongs to the AXUD1 family.

Chromosomal Location of Human Ortholog: 12q13.11-q13.12

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity; phosphatase binding

Biological Process: transcription, DNA-dependent; apoptosis; positive regulation of transcription from RNA polymerase II promoter

Research Articles on CSRNP2

Similar Products

Product Notes

The CSRNP2 csrnp2 (Catalog #AAA3243254) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CSRNP2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSRNP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSRNP2 csrnp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPENEDFHPS WSPSSLPFRT DNEEGCGMVK TSQQNEDRPP EDSSLELPLA. It is sometimes possible for the material contained within the vial of "CSRNP2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.