CRYZ blocking peptide

CRYZ Peptide - middle region

Cat. Num. AAA3246842

• Reactivity: Human
• Synonyms: CRYZ; CRYZ Peptide - middle region; CRYZ blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: VHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGD
• Sequence Length: 329

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CRYZ blocking peptide

This is a synthetic peptide designed for use in combination with anti- CRYZ Antibody, made

Target Description: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist.

Product Categories/Family for CRYZ blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 194239674
• NCBI GeneID: 1429
• NCBI Accession #: NP_001123514.1
• NCBI GenBank Nucleotide #: NM_001130042.1
• UniProt Accession #: Q08257
• Molecular Weight: 36 kDa
• NCBI Official Full Name: quinone oxidoreductase isoform a
• NCBI Official Synonym Full Names: crystallin zeta
• NCBI Official Symbol: CRYZ
• NCBI Protein Information: quinone oxidoreductase
• UniProt Protein Name: Quinone oxidoreductase
• Protein Family: Zeta-crystallin
• UniProt Gene Name: CRYZ

NCBI Description

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist. [provided by RefSeq, Sep 2008]

Uniprot Description

Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification of xenobiotics. Interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species. Enhances the stability of mRNA coding for BCL2. NADPH binding interferes with mRNA binding.