COL27A1 blocking peptide
COL27A1 Peptide - middle region
Gene Names
COL27A1; STLS
Reactivity
Human
Applications
Western Blot
Synonyms
COL27A1; COL27A1 Peptide - middle region; COL27A1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF
Sequence Length
827
Applicable Applications for COL27A1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for COL27A1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-COL27A1 Antibody, made
Target Description: Fibrillar collagens, such as COL27A1, compose one of the most ancient families of extracellular matrix molecules. They form major structural elements in extracellular matrices of cartilage, skin, and tendon.
Target Description: Fibrillar collagens, such as COL27A1, compose one of the most ancient families of extracellular matrix molecules. They form major structural elements in extracellular matrices of cartilage, skin, and tendon.
Product Categories/Family for COL27A1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
collagen alpha-1(XXVII) chain preproprotein
NCBI Official Synonym Full Names
collagen type XXVII alpha 1 chain
NCBI Official Symbol
COL27A1
NCBI Official Synonym Symbols
STLS
NCBI Protein Information
collagen alpha-1(XXVII) chain
UniProt Protein Name
Collagen alpha-1(XXVII) chain
Protein Family
UniProt Gene Name
COL27A1
UniProt Synonym Gene Names
KIAA1870
UniProt Entry Name
CORA1_HUMAN
NCBI Description
This gene encodes a member of the fibrillar collagen family, and plays a role during the calcification of cartilage and the transition of cartilage to bone. The encoded protein product is a preproprotein. It includes an N-terminal signal peptide, which is followed by an N-terminal propetide, mature peptide and a C-terminal propeptide. The N-terminal propeptide contains thrombospondin N-terminal-like and laminin G-like domains. The mature peptide is a major triple-helical region. The C-terminal propeptide, also known as COLFI domain, plays crucial roles in tissue growth and repair. Mutations in this gene cause Steel syndrome. Alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been determined. [provided by RefSeq, Sep 2014]
Research Articles on COL27A1
Similar Products
Product Notes
The COL27A1 col27a1 (Catalog #AAA3239554) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The COL27A1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COL27A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COL27A1 col27a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPGPKGDKGS RGDWGLQGPR GPPGPRGRPG PPGPPGGPIQ LQQDDLGAAF. It is sometimes possible for the material contained within the vial of "COL27A1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
