Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CLDN4 blocking peptide

CLDN4 Peptide - C-terminal region

Gene Names
CLDN4; CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
Reactivity
Human
Applications
Western Blot
Synonyms
CLDN4; CLDN4 Peptide - C-terminal region; CLDN4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS
Sequence Length
209
Applicable Applications for CLDN4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 20 degree C. Avoid repeat freezethaw cycles.
Related Product Information for CLDN4 blocking peptide
This is a synthetic peptide designed for use in combination with antiCLDN4 Antibody, made

Target Description: This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre and postnatal life. This gene is deleted in WilliamsBeuren syndrome, a neurodevelopmental disorder affecting multiple systems.
Product Categories/Family for CLDN4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
claudin-4
NCBI Official Synonym Full Names
claudin 4
NCBI Official Symbol
CLDN4
NCBI Official Synonym Symbols
CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
NCBI Protein Information
claudin-4
UniProt Protein Name
Claudin-4
Protein Family
UniProt Gene Name
CLDN4
UniProt Synonym Gene Names
CPER; CPETR1; WBSCR8; CPE-R
UniProt Entry Name
CLD4_HUMAN

NCBI Description

The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013]

Uniprot Description

Claudin-4: Plays a major role in tight junction-specific obliteration of the intercellular space. CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the claudin family.

Protein type: Membrane protein, multi-pass; Cytoskeletal; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: tight junction; apicolateral plasma membrane; integral to plasma membrane; apical plasma membrane; basal plasma membrane; plasma membrane; lateral plasma membrane

Molecular Function: identical protein binding; transmembrane receptor activity; structural molecule activity

Biological Process: female pregnancy; response to progesterone stimulus; signal transduction; calcium-independent cell-cell adhesion

Research Articles on CLDN4

Similar Products

Product Notes

The CLDN4 cldn4 (Catalog #AAA3226648) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CLDN4 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLDN4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLDN4 cldn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KREMGASLYV GWAASGLLLL GGGLLCCNCP PRTDKPYSAK YSAARSAAAS. It is sometimes possible for the material contained within the vial of "CLDN4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.