Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CHMP6 blocking peptide

CHMP6 Peptide - middle region

Gene Names
CHMP6; VPS20
Reactivity
Human
Applications
Western Blot
Synonyms
CHMP6; CHMP6 Peptide - middle region; CHMP6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
VMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFT
Sequence Length
201
Applicable Applications for CHMP6 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CHMP6 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CHMP6 Antibody, made

Target Description: This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein family. Proteins in this family are part of the ESCRT-III (endosomal sorting complex required for transport III) which degrades surface receptors, and in biosynthesis of endosomes.
Product Categories/Family for CHMP6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
charged multivesicular body protein 6
NCBI Official Synonym Full Names
charged multivesicular body protein 6
NCBI Official Symbol
CHMP6
NCBI Official Synonym Symbols
VPS20
NCBI Protein Information
charged multivesicular body protein 6
UniProt Protein Name
Charged multivesicular body protein 6
UniProt Gene Name
CHMP6
UniProt Synonym Gene Names
VPS20; Vps20; hVps20
UniProt Entry Name
CHMP6_HUMAN

NCBI Description

This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein family. Proteins in this family are part of the ESCRT-III (endosomal sorting complex required for transport III) which degrades surface receptors, and in biosynthesis of endosomes. [provided by RefSeq, Mar 2012]

Uniprot Description

CHMP6: Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. In the ESCRT-III complex, it probably serves as an acceptor for the ESCRT-II complex on endosomal membranes. Belongs to the SNF7 family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: membrane; late endosome membrane; cytosol

Molecular Function: protein binding; protein N-terminus binding

Biological Process: protein transport; cell separation during cytokinesis; viral reproduction; vacuolar transport; viral infectious cycle; endosome transport; mitotic metaphase plate congression; nuclear organization and biogenesis

Research Articles on CHMP6

Similar Products

Product Notes

The CHMP6 chmp6 (Catalog #AAA3241715) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CHMP6 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHMP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHMP6 chmp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VMEGLQFGNE CLNKMHQVMS IEEVERILDE TQEAVEYQRQ IDELLAGSFT. It is sometimes possible for the material contained within the vial of "CHMP6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.