Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CHEK1 blocking peptide

CHEK1 Peptide - middle region

Gene Names
CHEK1; CHK1
Reactivity
Human
Applications
Western Blot
Synonyms
CHEK1; CHEK1 Peptide - middle region; CHEK1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP
Sequence Length
476
Applicable Applications for CHEK1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CHEK1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CHEK1 Antibody, made

Target Description: CHEK1 is a serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest and activation of DNA repair in response to the presence of DNA damage or unreplicated DNA. It may also negatively regulate cell cycle progression during unperturbed cell cycles.
Product Categories/Family for CHEK1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
serine/threonine-protein kinase Chk1 isoform 1
NCBI Official Synonym Full Names
checkpoint kinase 1
NCBI Official Symbol
CHEK1
NCBI Official Synonym Symbols
CHK1
NCBI Protein Information
serine/threonine-protein kinase Chk1
UniProt Protein Name
Serine/threonine-protein kinase Chk1
UniProt Gene Name
CHEK1
UniProt Synonym Gene Names
CHK1
UniProt Entry Name
CHK1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Chk1: a protein kinase of the CAMKL family. Required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. May also negatively regulate cell cycle progression during unperturbed cell cycles. Plays an important role in both S and G2 checkpoints, embryonic development and tumor suppression. Phosphorylated and activated by ATM/ATR following DNA damage, it binds to single-stranded DNA and DNA ends and has a role in the repair of double strand breaks. Activated Chk1 can phosphorylate and inactivate cdc25C via phosphorylation and 14-3-3 binding, blocking the activation of cdc2 and transition into M-phase. Other substrates include p53. Implicated in resistance to apoptosis in response to chemotherapy. Inhibitors under development to chemosensitize tumors. Somatic mutations found in stomach tumors, and in colon and endometrial tumors, where CHK1 may be a target of microsatellite instability. Inhibitors: SB218078, UNC-01.

Protein type: Tumor suppressor; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; Kinase, protein; EC 2.7.11.1; CAMK group; CAMKL family; CHK1 subfamily

Chromosomal Location of Human Ortholog: 11q24.2

Cellular Component: nucleoplasm; centrosome; extracellular space; chromosome, telomeric region; condensed nuclear chromosome; intracellular membrane-bound organelle; replication fork; nucleus; chromatin; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: DNA damage induced protein phosphorylation; chromatin-mediated maintenance of transcription; regulation of mitotic centrosome separation; negative regulation of mitosis; DNA damage checkpoint; peptidyl-threonine phosphorylation; G2/M transition of mitotic cell cycle; G2/M transition DNA damage checkpoint; DNA repair; DNA replication; response to DNA damage stimulus; regulation of cell proliferation

Research Articles on CHEK1

Similar Products

Product Notes

The CHEK1 chek1 (Catalog #AAA3224958) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CHEK1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHEK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHEK1 chek1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPVNSASSEE NVKYSSSQPE PRTGLSLWDT SPSYIDKLVQ GISFSQPTCP. It is sometimes possible for the material contained within the vial of "CHEK1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.