CABLES1 blocking peptide

CABLES1 Peptide - C-terminal region

Cat. Num. AAA3241445

• Gene Names: CABLES1; CABL1; IK3-1; CABLES; HsT2563
• Reactivity: Human
• Applications: Western Blot
• Synonyms: CABLES1; CABLES1 Peptide - C-terminal region; CABLES1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: IRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGA
• Sequence Length: 633

• Applicable Applications for CABLES1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CABLES1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-CABLES1 Antibody, made

Target Description: This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers.Multiple transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for CABLES1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 154759423
• NCBI GeneID: 91768
• NCBI Accession #: NP_001094089
• NCBI GenBank Nucleotide #: NM_001100619
• UniProt Accession #: Q8TDN4
• Molecular Weight: 67kDa
• NCBI Official Full Name: CDK5 and ABL1 enzyme substrate 1 isoform 2
• NCBI Official Synonym Full Names: Cdk5 and Abl enzyme substrate 1
• NCBI Official Symbol: CABLES1
• NCBI Official Synonym Symbols: CABL1; IK3-1; CABLES; HsT2563
• NCBI Protein Information: CDK5 and ABL1 enzyme substrate 1
• UniProt Protein Name: CDK5 and ABL1 enzyme substrate 1
• Protein Family: CDK5 and ABL1 enzyme substrate
• UniProt Gene Name: CABLES1
• UniProt Synonym Gene Names: CABLES; Ik3-1
• UniProt Entry Name: CABL1_HUMAN

NCBI Description

This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study (PMID: 16177568) reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers (PMID: 17982127).Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

CABLES1: Cyclin-dependent kinase binding protein. Enhances cyclin-dependent kinase tyrosine phosphorylation by nonreceptor tyrosine kinases, such as that of CDK5 by activated ABL1, which leads to increased CDK5 activity and is critical for neuronal development, and that of CDK2 by WEE1, which leads to decreased CDK2 activity and growth inhibition. Positively affects neuronal outgrowth. Plays a role as a regulator for p53/p73-induced cell death. Belongs to the cyclin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 18q11.2

Cellular Component: cytosol; nucleus

Molecular Function: protein binding

Biological Process: nervous system development; cell division; blood coagulation; cell cycle