Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C5AR1 blocking peptide

C5AR1 Peptide - C-terminal region

Gene Names
C5AR1; C5A; C5AR; C5R1; CD88
Reactivity
Human
Applications
Western Blot
Synonyms
C5AR1; C5AR1 Peptide - C-terminal region; C5AR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK
Sequence Length
350
Applicable Applications for C5AR1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for C5AR1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-C5AR1 Antibody, made

Target Description: C5AR1 is the receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
Product Categories/Family for C5AR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
728
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
C5a anaphylatoxin chemotactic receptor 1
NCBI Official Synonym Full Names
complement C5a receptor 1
NCBI Official Symbol
C5AR1
NCBI Official Synonym Symbols
C5A; C5AR; C5R1; CD88
NCBI Protein Information
C5a anaphylatoxin chemotactic receptor 1
UniProt Protein Name
C5a anaphylatoxin chemotactic receptor
UniProt Gene Name
C5AR1
UniProt Synonym Gene Names
C5AR; C5R1; C5a-R; C5aR
UniProt Entry Name
C5AR_HUMAN

Uniprot Description

C5aR: a family 1 G-protein coupled receptor that stimulates the GTPase activity of Gi2. Receptor for the chemotactic and inflammatory complement factor C5a. Stimulates chemotaxis, granule enzyme release and superoxide anion production. Phosphorylated in response to C5a or after stimulation of cells with phorbol esters. Expressed on monocytes, granulocytes, dendritic cells, astrocytes and microglia.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: cell surface; basolateral plasma membrane; integral to plasma membrane; apical part of cell; cytoplasmic membrane-bound vesicle; plasma membrane

Molecular Function: complement component C5a receptor activity; complement component C5a binding; C5a anaphylatoxin receptor activity

Biological Process: neutrophil chemotaxis; organ regeneration; sensory perception of chemical stimulus; activation of MAPK activity; apoptosis; response to lipopolysaccharide; chemotaxis; cell proliferation in hindbrain; signal transduction; mRNA transcription from RNA polymerase II promoter; elevation of cytosolic calcium ion concentration; defense response to Gram-positive bacterium; phospholipase C activation; response to peptidoglycan; cellular defense response; immune response; negative regulation of neuron apoptosis; inflammatory response; positive regulation of epithelial cell proliferation

Research Articles on C5AR1

Similar Products

Product Notes

The C5AR1 c5ar1 (Catalog #AAA3239583) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The C5AR1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C5AR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C5AR1 c5ar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SHDKRRERAV AIVRLVLGFL WPLLTLTICY TFILLRTWSR RATRSTKTLK. It is sometimes possible for the material contained within the vial of "C5AR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.