Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BNIP2 blocking peptide

BNIP2 Peptide - C-terminal region

Gene Names
BNIP2; NIP2; BNIP-2
Reactivity
Human
Synonyms
BNIP2; BNIP2 Peptide - C-terminal region; BNIP2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNE
Sequence Length
314
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BNIP2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- BNIP2 Antibody, made

Target Description: This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. Alternate splicing results in multiple transcript variants.
Product Categories/Family for BNIP2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
663
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 isoform 2
NCBI Official Synonym Full Names
BCL2 interacting protein 2
NCBI Official Symbol
BNIP2
NCBI Official Synonym Symbols
NIP2; BNIP-2
NCBI Protein Information
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
UniProt Protein Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
UniProt Gene Name
BNIP2
UniProt Synonym Gene Names
NIP2
UniProt Entry Name
BNIP2_HUMAN

NCBI Description

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

BNIP2: Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: intracellular membrane-bound organelle; perinuclear region of cytoplasm; cytoplasm; nuclear envelope; cytosol

Molecular Function: identical protein binding; protein binding; calcium ion binding; GTPase activator activity

Biological Process: muscle cell differentiation; apoptosis; positive regulation of muscle cell differentiation; positive regulation of GTPase activity; negative regulation of apoptosis

Research Articles on BNIP2

Similar Products

Product Notes

The BNIP2 bnip2 (Catalog #AAA3248057) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BNIP2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISSKFSQKIR YVFNLAELAE LVPMEYVGIP ECIKQVDQEL NGKQDEPKNE. It is sometimes possible for the material contained within the vial of "BNIP2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.