Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BMI1 blocking peptide

BMI1 Peptide - middle region

Gene Names
COMMD3-BMI1; BMI1; PCGF4; RNF51
Reactivity
Human
Synonyms
BMI1; BMI1 Peptide - middle region; BMI1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMD
Sequence Length
326
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BMI1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- BMI1 Antibody, made

Target Description: This locus represents naturally occurring read-through transcription between the neighboring COMM domain-containing protein 3 and polycomb complex protein BMI-1 genes on chromosome 10. The read-through transcript produces a fusion protein that shares sequence identity with each individual gene product.
Product Categories/Family for BMI1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
COMMD3-BMI1 read-through protein
NCBI Official Synonym Full Names
COMMD3-BMI1 readthrough
NCBI Official Symbol
COMMD3-BMI1
NCBI Official Synonym Symbols
BMI1; PCGF4; RNF51
NCBI Protein Information
COMMD3-BMI1 read-through protein
UniProt Protein Name
Polycomb complex protein BMI-1
Protein Family
UniProt Gene Name
BMI1
UniProt Synonym Gene Names
PCGF4; RNF51
UniProt Entry Name
BMI1_HUMAN

NCBI Description

This locus represents naturally occurring read-through transcription between the neighboring COMM domain-containing protein 3 and polycomb complex protein BMI-1 genes on chromosome 10. The read-through transcript produces a fusion protein that shares sequence identity with each individual gene product. [provided by RefSeq, Feb 2011]

Uniprot Description

BMI1: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. Component of a PRC1-like complex. Interacts with RING1 and RING2. Interacts vwith CBX7 and CBX8. Interacts with SPOP. Part of a complex consisting of BMI1, CUL3 and SPOP. Interacts with E4F1.

Protein type: Motility/polarity/chemotaxis; Oncoprotein; Ligase; EC 6.3.2.-; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 10p11.23

Cellular Component: nucleoplasm; nuclear body; heterochromatin; cytoplasm; PcG protein complex; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; sequence-specific DNA binding; ubiquitin-protein ligase activity; chromatin binding

Biological Process: transcription, DNA-dependent; in utero embryonic development; positive regulation of immature T cell proliferation in the thymus; negative regulation of transcription from RNA polymerase II promoter; humoral immune response; embryonic skeletal morphogenesis; segment specification; rostrocaudal neural tube patterning; positive regulation of fibroblast proliferation; regulation of gene expression; positive regulation of ubiquitin-protein ligase activity; histone ubiquitination; DNA methylation; positive regulation of B cell proliferation; somatic stem cell division; hemopoiesis; brain development; histone acetylation

Similar Products

Product Notes

The BMI1 bmi1 (Catalog #AAA3246986) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BMI1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEFFDQNRLD RKVNKDKEKS KEEVNDKRYL RCPAAMTVMH LRKFLRSKMD. It is sometimes possible for the material contained within the vial of "BMI1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.