Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BAG6 blocking peptide

BAG6 Peptide - C-terminal region

Gene Names
BAG6; G3; BAT3; BAG-6; D6S52E
Reactivity
Human
Applications
Western Blot
Synonyms
BAG6; BAG6 Peptide - C-terminal region; BAG6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQ
Sequence Length
1132
Applicable Applications for BAG6 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BAG6 blocking peptide
This is a synthetic peptide designed for use in combination with anti-BAG6 Antibody, made

Target Description: This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage.
Product Categories/Family for BAG6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125kDa
NCBI Official Full Name
large proline-rich protein BAG6 isoform a
NCBI Official Synonym Full Names
BCL2 associated athanogene 6
NCBI Official Symbol
BAG6
NCBI Official Synonym Symbols
G3; BAT3; BAG-6; D6S52E
NCBI Protein Information
large proline-rich protein BAG6
UniProt Protein Name
Large proline-rich protein BAG6
UniProt Gene Name
BAG6
UniProt Synonym Gene Names
BAT3; G3; BAG-6; BAG6
UniProt Entry Name
BAG6_HUMAN

NCBI Description

This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

BAT3: Chaperone that plays a key role in various processes such as apoptosis, insertion of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane and regulation of chromatin. Acts in part by regulating stability of proteins and their degradation by the proteasome. Participates in endoplasmic reticulum stress-induced apoptosis via its interaction with AIFM1/AIF by regulating AIFM1/AIF stability and preventing its degradation. Also required during spermatogenesis for synaptonemal complex assembly via its interaction with HSPA2, by inhibiting polyubiquitination and subsequent proteasomal degradation of HSPA2. Required for selective ubiquitin-mediated degradation of defective nascent chain polypeptides by the proteasome. In this context, may play a role in immuno-proteasomes to generate antigenic peptides via targeted degradation, thereby playing a role in antigen presentation in immune response. Key component of the BAG6/BAT3 complex, a cytosolic multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. BAG6/BAT3 acts by facilitating TA membrane proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins and transfers them to ASNA1/TRC40 for targeting to the endoplasmic reticulum membrane. Component of the BAT3 complex, at least composed of BAG6/BAT3, UBL4A and GET3/TRC35. Interacts with AIFM1, CTCFL, HSPA2 and p300/EP300. Interacts with ricin A chain. Interacts with L.pneumophila proteins Lpg2160 and LegU1. Interacts with NCR3. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Apoptosis; Cell cycle regulation; Chaperone

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding; ribosome binding; Hsp70 protein binding; polyubiquitin binding

Biological Process: ubiquitin-dependent protein catabolic process; negative regulation of proteolysis; synaptonemal complex assembly; internal peptidyl-lysine acetylation; protein stabilization; immune system process; chromatin modification; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; regulation of cell proliferation; embryonic development; transport; spermatogenesis; brain development; kidney development; cell differentiation; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; lung development; negative regulation of apoptosis

Research Articles on BAG6

Similar Products

Product Notes

The BAG6 bag6 (Catalog #AAA3240198) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BAG6 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAG6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BAG6 bag6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ARPLTSPESL SRDLEAPEVQ ESYRQQLRSD IQKRLQEDPN YSPQRFPNAQ. It is sometimes possible for the material contained within the vial of "BAG6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.