AWAT1 blocking peptide
AWAT1 Peptide - middle region
Gene Names
AWAT1; DGA2; DGAT2L3
Reactivity
Human
Applications
Western Blot
Synonyms
AWAT1; AWAT1 Peptide - middle region; AWAT1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVC
Sequence Length
328
Applicable Applications for AWAT1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AWAT1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DGAT2L3 Antibody, made
Target Description: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.
Target Description: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.
Product Categories/Family for AWAT1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
acyl-CoA wax alcohol acyltransferase 1
NCBI Official Synonym Full Names
acyl-CoA wax alcohol acyltransferase 1
NCBI Official Symbol
AWAT1
NCBI Official Synonym Symbols
DGA2; DGAT2L3
NCBI Protein Information
acyl-CoA wax alcohol acyltransferase 1
UniProt Protein Name
Acyl-CoA wax alcohol acyltransferase 1
Protein Family
UniProt Gene Name
AWAT1
UniProt Synonym Gene Names
DGA2; DGAT2L3
UniProt Entry Name
AWAT1_HUMAN
NCBI Description
The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. [provided by RefSeq, Sep 2009]
Research Articles on AWAT1
1. analysis of AWAT1 and AWAT2 substrate specificity and differentiation-specific expression pattern
Similar Products
Product Notes
The AWAT1 awat1 (Catalog #AAA3232437) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AWAT1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AWAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AWAT1 awat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLTFGAFCNF CTEATGFSKT FPGITPHLAT LSWFFKIPFV REYLMAKGVC. It is sometimes possible for the material contained within the vial of "AWAT1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
