Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP6AP2 blocking peptide

ATP6AP2 Peptide - middle region

Gene Names
ATP6AP2; PRR; M8-9; MRXE; RENR; XMRE; XPDS; HT028; MRXSH; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9
Reactivity
Human
Applications
Western Blot
Synonyms
ATP6AP2; ATP6AP2 Peptide - middle region; ATP6AP2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVV
Sequence Length
350
Applicable Applications for ATP6AP2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATP6AP2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATP6AP2 Antibody, made

Target Description: This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.
Product Categories/Family for ATP6AP2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
renin receptor
NCBI Official Synonym Full Names
ATPase H+ transporting accessory protein 2
NCBI Official Symbol
ATP6AP2
NCBI Official Synonym Symbols
PRR; M8-9; MRXE; RENR; XMRE; XPDS; HT028; MRXSH; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9
NCBI Protein Information
renin receptor
UniProt Protein Name
Renin receptor
Protein Family
UniProt Gene Name
ATP6AP2
UniProt Synonym Gene Names
ATP6IP2; CAPER; ELDF10; ATP6M8-9
UniProt Entry Name
RENR_HUMAN

NCBI Description

This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP6AP2: Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS). Defects in ATP6AP2 are a cause of mental retardation X- linked with epilepsy (MRXE). MRXE is a syndromic mental retardation. Patients manifest mild to moderate mental retardation associated with epilepsy, delays in motor milestones and speech acquisition in infancy.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp11.4

Cellular Component: neuron projection; integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; enzyme binding; receptor activity; aspartic-type endopeptidase activity

Biological Process: positive regulation of transforming growth factor-beta1 production; rostrocaudal neural tube patterning; cellular protein metabolic process; regulation of MAPKKK cascade; proteolysis; angiotensin maturation; positive regulation of Wnt receptor signaling pathway; eye pigmentation

Disease: Mental Retardation, X-linked, Syndromic, Hedera Type; Parkinsonism With Spasticity, X-linked

Research Articles on ATP6AP2

Similar Products

Product Notes

The ATP6AP2 atp6ap2 (Catalog #AAA3245900) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATP6AP2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6AP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP6AP2 atp6ap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSLELAGLDE IGKRYGEDSE QFRDASKILV DALQKFADDM YSLYGGNAVV. It is sometimes possible for the material contained within the vial of "ATP6AP2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.