Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATF4P3 blocking peptide

ATF4P3 Peptide - middle region

Gene Names
ATF4P3; ATF4C
Reactivity
Human
Applications
Western Blot
Synonyms
ATF4P3; ATF4P3 Peptide - middle region; ATF4P3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSAHPKPYDPP
Sequence Length
351
Applicable Applications for ATF4P3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATF4P3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-LOC643159 Antibody, made

Target Description: The function of the protein remains unknown.
Product Categories/Family for ATF4P3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Synonym Full Names
activating transcription factor 4 pseudogene 3
NCBI Official Symbol
ATF4P3
NCBI Official Synonym Symbols
ATF4C
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-4
UniProt Gene Name
ATF4
UniProt Synonym Gene Names
CREB2; TXREB; cAMP-dependent transcription factor ATF-4; CREB-2; cAMP-responsive element-binding protein 2; TaxREB67
UniProt Entry Name
ATF4_HUMAN

Uniprot Description

ATF-4: a transcription factor that is a member of the leucine zipper family. Isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). Involved in cisplatin resistance. Other members of the family include AP-1 transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. Two alternatively spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; neuron projection; cytoplasm; microtubule organizing center; nucleus

Molecular Function: protein C-terminus binding; protein binding; leucine zipper domain binding; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; amino acid metabolic process; unfolded protein response; positive regulation of apoptosis; negative regulation of potassium ion transport; positive regulation of transcription, DNA-dependent; gluconeogenesis; positive regulation of transcription from RNA polymerase I promoter; cellular response to glucose starvation; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; regulation of transcription, DNA-dependent; positive regulation of neuron apoptosis; positive regulation of transcription from RNA polymerase II promoter; circadian regulation of gene expression; gamma-aminobutyric acid signaling pathway

Similar Products

Product Notes

The ATF4P3 atf4 (Catalog #AAA3235173) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATF4P3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATF4P3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATF4P3 atf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDNDSGICMS PESYLGSPQH SPSTRGSPNR SLPSPGVLCG SAHPKPYDPP. It is sometimes possible for the material contained within the vial of "ATF4P3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.