Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

APOC3 blocking peptide

APOC3 Peptide - middle region

Gene Names
APOC3; APOCIII
Reactivity
Human
Synonyms
APOC3; APOC3 Peptide - middle region; APOC3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKF
Sequence Length
99
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for APOC3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- APOC3 Antibody, made

Target Description: Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia.
Product Categories/Family for APOC3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
345
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10 kDa
NCBI Official Full Name
apolipoprotein C-III
NCBI Official Synonym Full Names
apolipoprotein C3
NCBI Official Symbol
APOC3
NCBI Official Synonym Symbols
APOCIII
NCBI Protein Information
apolipoprotein C-III
UniProt Protein Name
Apolipoprotein C-III
Protein Family
UniProt Gene Name
APOC3
UniProt Synonym Gene Names
Apo-CIII; ApoC-III
UniProt Entry Name
APOC3_HUMAN

NCBI Description

This gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. The encoded protein plays a role in role in the metabolism of these TRLs through multiple modes. This protein has been shown to promote the secretion of VLDL1, inhibit lipoprotein lipase enzyme activity, and delay catabolism of TRL remnants. Mutations in this gene are associated with low plasma triglyceride levels and reduced risk of ischemic cardiovascular disease, and hyperalphalipoproteinemia, which is characterized by elevated levels of high density lipoprotein (HDL) and HDL cholesterol in human patients. This gene and other related genes comprise an apolipoprotein gene cluster on chromosome 11. [provided by RefSeq, Sep 2017]

Uniprot Description

APOC3: Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles. Defects in APOC3 are the cause of hyperalphalipoproteinemia type 2 (HALP2). HALP2 is a condition characterized by high levels of high density lipoprotein (HDL) and increased HDL cholesterol levels. Belongs to the apolipoprotein C3 family.

Protein type: Secreted; Secreted, signal peptide; Lipid-binding

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: extracellular space; chylomicron; early endosome; extracellular region

Molecular Function: lipase inhibitor activity; cholesterol binding; phospholipid binding; enzyme regulator activity

Biological Process: response to drug; cholesterol metabolic process; response to peptide hormone stimulus; phototransduction, visible light; regulation of Cdc42 protein signal transduction; lipoprotein metabolic process; cholesterol efflux; G-protein coupled receptor protein signaling pathway; cholesterol homeostasis; triacylglycerol metabolic process; reverse cholesterol transport; negative regulation of lipid catabolic process; phospholipid efflux; lipoprotein transport; triacylglycerol catabolic process; negative regulation of lipoprotein lipase activity; negative regulation of receptor-mediated endocytosis; negative regulation of lipid metabolic process; retinoid metabolic process; inflammatory response; triacylglycerol mobilization; negative regulation of fatty acid biosynthetic process; response to nutrient

Disease: Apolipoprotein C-iii Deficiency

Research Articles on APOC3

Similar Products

Product Notes

The APOC3 apoc3 (Catalog #AAA3245800) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The APOC3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQGYMKHATK TAKDALSSVQ ESQVAQQARG WVTDGFSSLK DYWSTVKDKF. It is sometimes possible for the material contained within the vial of "APOC3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.