Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ALCAM blocking peptide

ALCAM Peptide - middle region

Gene Names
ALCAM; MEMD; CD166
Reactivity
Human
Synonyms
ALCAM; ALCAM Peptide - middle region; ALCAM blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVI
Sequence Length
583
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ALCAM blocking peptide
This is a synthetic peptide designed for use in combination with anti- ALCAM Antibody, made

Target Description: This gene encodes activated leukocyte cell adhesion molecule (ALCAM), also known as CD166 (cluster of differentiation 166), which is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular domain. This protein binds to T-cell differentiation antigene CD6, and is implicated in the processes of cell adhesion and migration. Multiple alternatively spliced transcript variants encoding different isoforms have been found.
Product Categories/Family for ALCAM blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
214
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64 kDa
NCBI Official Full Name
CD166 antigen isoform 2
NCBI Official Synonym Full Names
activated leukocyte cell adhesion molecule
NCBI Official Symbol
ALCAM
NCBI Official Synonym Symbols
MEMD; CD166
NCBI Protein Information
CD166 antigen
UniProt Protein Name
CD166 antigen
Protein Family
UniProt Gene Name
ALCAM
UniProt Synonym Gene Names
MEMD
UniProt Entry Name
CD166_HUMAN

NCBI Description

This gene encodes activated leukocyte cell adhesion molecule (ALCAM), also known as CD166 (cluster of differentiation 166), which is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular domain. This protein binds to T-cell differentiation antigene CD6, and is implicated in the processes of cell adhesion and migration. Multiple alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Aug 2011]

Uniprot Description

ALCAM: Cell adhesion molecule that binds to CD6. Involved in neurite extension by neurons via heterophilic and homophilic interactions. May play a role in the binding of T- and B-cells to activated leukocytes, as well as in interactions between cells of the nervous system. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 3q13.1

Cellular Component: focal adhesion; cell soma; axon; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; receptor binding

Biological Process: axon guidance; motor axon guidance; signal transduction; cell adhesion

Research Articles on ALCAM

Similar Products

Product Notes

The ALCAM alcam (Catalog #AAA3246257) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ALCAM Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEIVSKALFL ETEQLKKLGD CISEDSYPDG NITWYRNGKV LHPLEGAVVI. It is sometimes possible for the material contained within the vial of "ALCAM, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.