Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AIM2 blocking peptide

AIM2 Peptide - C-terminal region

Gene Names
AIM2; PYHIN4
Reactivity
Human
Synonyms
AIM2; AIM2 Peptide - C-terminal region; AIM2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVI
Sequence Length
343
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AIM2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-AIM2 Antibody, made

Target Description: AIM2 is a member of the IFI20X /IFI16 family. It plays a putative role in tumorigenic reversion and may control cell proliferation. Interferon-gamma induces expression of AIM2.
Product Categories/Family for AIM2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
interferon-inducible protein AIM2 isoform 1
NCBI Official Synonym Full Names
absent in melanoma 2
NCBI Official Symbol
AIM2
NCBI Official Synonym Symbols
PYHIN4
NCBI Protein Information
interferon-inducible protein AIM2
UniProt Protein Name
Interferon-inducible protein AIM2
Protein Family
UniProt Gene Name
AIM2
UniProt Entry Name
AIM2_HUMAN

NCBI Description

AIM2 is a member of the IFI20X /IFI16 family. It plays a putative role in tumorigenic reversion and may control cell proliferation. Interferon-gamma induces expression of AIM2. [provided by RefSeq, Jul 2008]

Uniprot Description

AIM2: a tumor suppressor which may act by repressing NF-kappa-B transcriptional activity. Induced by interferon gamma. Defects in AIM2 may be a cause of microsatellite unstable colon cancers. AIM2 and various NOD-like receptors form multiprotein complexes called inflammasomes, which mediate caspase-1-dependent processing of pro-IL-1beta.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; double-stranded DNA binding

Biological Process: positive regulation of protein oligomerization; positive regulation of interleukin-1 beta production; tumor necrosis factor-mediated signaling pathway; apoptosis; inhibition of NF-kappaB transcription factor; innate immune response; immune response; interleukin-1 beta secretion; positive regulation of interleukin-1 beta secretion; inflammatory response; positive regulation of defense response to virus by host; activation of innate immune response; activation of NF-kappaB transcription factor

Research Articles on AIM2

Similar Products

Product Notes

The AIM2 aim2 (Catalog #AAA3234919) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AIM2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGKMEVLGVR NEDTMKCKEG DKVRLTFFTL SKNGEKLQLT SGVHSTIKVI. It is sometimes possible for the material contained within the vial of "AIM2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.