Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ACAP1 blocking peptide

ACAP1 Peptide - C-terminal region

Gene Names
ACAP1; CENTB1
Reactivity
Human
Applications
Western Blot
Synonyms
ACAP1; ACAP1 Peptide - C-terminal region; ACAP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IVTLLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDL
Sequence Length
740
Applicable Applications for ACAP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for ACAP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82 kDa
NCBI Official Full Name
arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
NCBI Official Synonym Full Names
ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
NCBI Official Symbol
ACAP1
NCBI Official Synonym Symbols
CENTB1
NCBI Protein Information
arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
UniProt Protein Name
Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
UniProt Gene Name
ACAP1
UniProt Synonym Gene Names
CENTB1; KIAA0050; Cnt-b1
UniProt Entry Name
ACAP1_HUMAN

Uniprot Description

CENTB1: a member of the centaurin family of ADP-ribosylation factor directed GTPase-activating proteins (GAPs). A GAP for ARF1 and ARF5. Two alternatively-spliced isoforms have been described. Isoform 1 is brain-specific, and isoform 2 is ubiquitously expressed, with highest levels in brain and heart. Isoform 1 participates to the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. Regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. The PH domains of isoforms 1 and 2 bind phospholipids, but they differentially regulate subcellular location. The PH domain of isoform 1 directs the protein to the nucleus, but the PH domain of isoform 2 directs it to the cytosol.

Protein type: Motility/polarity/chemotaxis; GAPs, ARF; GAPs

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: membrane; recycling endosome membrane

Molecular Function: zinc ion binding

Biological Process: protein transport; positive regulation of GTPase activity

Research Articles on ACAP1

Similar Products

Product Notes

The ACAP1 acap1 (Catalog #AAA3245701) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ACAP1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACAP1 acap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVTLLRLAKM REAEAAQGQA GDETYLDIFR DFSLMASDDP EKLSRRSHDL. It is sometimes possible for the material contained within the vial of "ACAP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.