Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ACAD9 blocking peptide

ACAD9 Peptide - C-terminal region

Gene Names
ACAD9; NPD002; MC1DN20
Reactivity
Human
Applications
Western Blot
Synonyms
ACAD9; ACAD9 Peptide - C-terminal region; ACAD9 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV
Sequence Length
621
Applicable Applications for ACAD9 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ACAD9 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ACAD9 Antibody, made

Target Description: This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency.
Product Categories/Family for ACAD9 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
acyl-CoA dehydrogenase family member 9, mitochondrial
NCBI Official Synonym Full Names
acyl-CoA dehydrogenase family member 9
NCBI Official Symbol
ACAD9
NCBI Official Synonym Symbols
NPD002; MC1DN20
NCBI Protein Information
acyl-CoA dehydrogenase family member 9, mitochondrial
UniProt Protein Name
Acyl-CoA dehydrogenase family member 9, mitochondrial
UniProt Gene Name
ACAD9
UniProt Synonym Gene Names
ACAD-9
UniProt Entry Name
ACAD9_HUMAN

NCBI Description

This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2010]

Uniprot Description

ACAD9: Has a dehydrogenase activity on palmitoyl-CoA (C16:0) and stearoyl-CoA (C18:0). It is three times more active on palmitoyl-CoA then on stearoyl-CoA. Has little activity on octanoyl-CoA (C8:0), butyryl-CoA (C4:0) or isovaleryl-CoA (5:0). Belongs to the acyl-CoA dehydrogenase family.

Protein type: EC 1.3.99.-; Mitochondrial; Oxidoreductase

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: mitochondrion; dendrite; nucleus

Molecular Function: acyl-CoA dehydrogenase activity; protein binding; FAD binding

Biological Process: mitochondrial respiratory chain complex I assembly

Disease: Acyl-coa Dehydrogenase Family, Member 9, Deficiency Of

Research Articles on ACAD9

Similar Products

Product Notes

The ACAD9 acad9 (Catalog #AAA3239881) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ACAD9 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACAD9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACAD9 acad9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RSIRIGLRNH DHEVLLANTF CVEAYLQNLF SLSQLDKYAP ENLDEQIKKV. It is sometimes possible for the material contained within the vial of "ACAD9, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.