ABLIM1 blocking peptide
ABLIM1 Peptide - middle region
Gene Names
ABLIM1; ABLIM; LIMAB1; LIMATIN; abLIM-1
Reactivity
Human
Applications
Western Blot
Synonyms
ABLIM1; ABLIM1 Peptide - middle region; ABLIM1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKES
Sequence Length
167
Applicable Applications for ABLIM1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ABLIM1 blocking peptide
This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for ABLIM1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88 kDa
NCBI Official Full Name
actin-binding LIM protein 1 isoform b
NCBI Official Synonym Full Names
actin binding LIM protein 1
NCBI Official Symbol
ABLIM1
NCBI Official Synonym Symbols
ABLIM; LIMAB1; LIMATIN; abLIM-1
NCBI Protein Information
actin-binding LIM protein 1
UniProt Protein Name
Actin-binding LIM protein 1
Protein Family
UniProt Gene Name
ABLIM1
UniProt Synonym Gene Names
ABLIM; KIAA0059; LIMAB1; abLIM-1
NCBI Description
This gene encodes a LIM zinc-binding domain-containing protein that binds to actin filaments and mediates interactions between actin and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jun 2017]
Uniprot Description
May act as scaffold protein (). May play a role in the development of the retina. Has been suggested to play a role in axon guidance.
Research Articles on ABLIM1
Similar Products
Product Notes
The ABLIM1 ablim1 (Catalog #AAA3245124) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ABLIM1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABLIM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABLIM1 ablim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGPDMKRRSS GREEDDEELL RRRQLQEEQL MKLNSGLGQL ILKEEMEKES. It is sometimes possible for the material contained within the vial of "ABLIM1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
