Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Serine protease HTRA2, mitochondrial (HTRA2) Recombinant Protein | HTRA2 recombinant protein

Recombinant Human Serine protease HTRA2, mitochondrial (HTRA2)

Gene Names
HTRA2; OMI; PARK13; PRSS25
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine protease HTRA2; mitochondrial (HTRA2); Recombinant Human Serine protease HTRA2; Recombinant Serine protease HTRA2; mitochondrial EC= 3.4.21.108; High temperature requirement protein A2; HtrA2 Omi stress-regulated endoprotease Serine protease 25 Serine proteinase OMI; HTRA2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
134-458
Sequence
AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Sequence Length
458
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,841 Da
NCBI Official Full Name
serine protease HTRA2, mitochondrial isoform 1 preproprotein
NCBI Official Synonym Full Names
HtrA serine peptidase 2
NCBI Official Symbol
HTRA2
NCBI Official Synonym Symbols
OMI; PARK13; PRSS25
NCBI Protein Information
serine protease HTRA2, mitochondrial; serine protease 25; protease, serine, 25; serine proteinase OMI; HtrA-like serine protease; Omi stress-regulated endoprotease; high temperature requirement protein A2
UniProt Protein Name
Serine protease HTRA2, mitochondrial
Protein Family
UniProt Gene Name
HTRA2
UniProt Synonym Gene Names
OMI; PRSS25; HtrA2
UniProt Entry Name
HTRA2_HUMAN

NCBI Description

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

HTRA2: a serine proteinase that normally resides in mitochondrial membranes. It exists in two populations in mitochondria: as an unprocessed form probably attached to the inner mitochondrial membrane through a N-terminal transmembrane domain, and as a processed form containing a reaper motif at its N-terminus. Following apoptotic stimuli it is autoproteolytically activated and released into the cytosol, where it promotes programmed cell death in caspase-dependent and -independent manners. The amino-terminal reaper motif binds to the IAP (inhibitor of apoptosis) proteins cIAP1, cIAP2, and and XIAP, disrupting IAP-caspase complexes in a manner similar to Smac/DIABLO. Phosphorylation by the protein kinase Akt attenuates its serine protease and pro-apoptotic activities. The PDZ domain mediates interaction with Mxi2, an alternatively spliced form of the p38 stress-activated kinase. In contrast to its pro-apoptotic effects, targeted deletion in mice indicates that it is involved in protection against cell stress in striatial neurons. Defects in HTRA2 are the cause of Parkinson disease 13 (PARK13). Four alternatively spliced human isoforms have been described.

Protein type: Mitochondrial; EC 3.4.21.108; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: endoplasmic reticulum membrane; internal side of plasma membrane; cytoskeleton; membrane; mitochondrion; endoplasmic reticulum; mitochondrial membrane; mitochondrial intermembrane space; chromatin; cytosol; nucleus

Molecular Function: peptidase activity; protein binding; serine-type peptidase activity; serine-type endopeptidase activity; unfolded protein binding

Biological Process: protein autoprocessing; mitochondrion organization and biogenesis; DNA damage response, signal transduction resulting in induction of apoptosis; pentacyclic triterpenoid metabolic process; cellular protein catabolic process; positive regulation of apoptosis; forebrain development; positive regulation of caspase activity; neuron development; regulation of multicellular organism growth; response to herbicide; proteolysis; ceramide metabolic process; adult walking behavior; negative regulation of cell cycle

Disease: Parkinson Disease 13, Autosomal Dominant, Susceptibility To

Research Articles on HTRA2

Similar Products

Product Notes

The HTRA2 htra2 (Catalog #AAA1117833) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 134-458. The amino acid sequence is listed below: AVPSPPPASP RSQYNFIADV VEKTAPAVVY IEILDRHPFL GREVPISNGS GFVVAADGLI VTNAHVVADR RRVRVRLLSG DTYEAVVTAV DPVADIATLR IQTKEPLPTL PLGRSADVRQ GEFVVAMGSP FALQNTITSG IVSSAQRPAR DLGLPQTNVE YIQTDAAIDF GNSGGPLVNL DGEVIGVNTM KVTAGISFAI PSDRLREFLH RGEKKNSSSG ISGSQRRYIG VMMLTLSPSI LAELQLREPS FPDVQHGVLI HKVILGSPAH RAGLRPGDVI LAIGEQMVQN AEDVYEAVRT QSQLAVQIRR GRETLTLYVT PEVTE. It is sometimes possible for the material contained within the vial of "Serine protease HTRA2, mitochondrial (HTRA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.