Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 2B Recombinant Protein | HTR2B recombinant protein

5-hydroxytryptamine receptor 2B

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 2B; HTR2B recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-96aa; full length protein
Sequence
CNQSTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYKATKSVKTVRKCS NKIYFRNPMTENSKFFMKHGMRNGINSTMYQSPVRL
Sequence Length
Full Length Protein
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for HTR2B recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for HTR2B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
11,226 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 2B
UniProt Protein Name
5-hydroxytryptamine receptor 2B
UniProt Gene Name
HTR2B
UniProt Synonym Gene Names
5-HT-2B; 5-HT2B
UniProt Entry Name
5HT2B_CAVPO

Uniprot Description

G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca2+ ions from intracellular stores. Plays a role in the regulation of dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake and in the regulation of extracellular dopamine and 5-hydroxytryptamine levels, and thereby affects neural activity. May play a role in the perception of pain. Plays a role in the regulation of behavior, including impulsive behavior. Required for normal proliferation of embryonic cardiac myocytes and normal heart development. Protects cardiomyocytes against apoptosis. Plays a role in the adaptation of pulmonary arteries to chronic hypoxia. Plays a role in vasoconstriction. Required for normal osteoblast function and proliferation, and for maintaining normal bone density. Required for normal proliferation of the interstitial cells of Cajal in the intestine ().

Similar Products

Product Notes

The HTR2B htr2b (Catalog #AAA7042869) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-96aa; full length protein. The amino acid sequence is listed below: CNQSTLQMLL EIFVWIGYVS SGVNPLVYTL FNKTFRDAFG RYITCNYKAT KSVKTVRKCS NKIYFRNPMT ENSKFFMKHG MRNGINSTMY QSPVRL. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 2B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.