Homeobox protein homothorax (hth) Recombinant Protein | hth recombinant protein
Recombinant Drosophila melanogaster Homeobox protein homothorax (hth)
Gene Names
hth; 1323/07; 1422/04; anon-EST:Liang-2.13; CG17117; clone 2.13; Dm-HTH; DmelCG17117; dtl; Hth; HTH; hth1; hth2; l(3)05745; l(3)86Ca; Meis1; P53
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Homeobox protein homothorax (hth); Recombinant Drosophila melanogaster Homeobox protein homothorax (hth); hth recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-487, Full length protein
Sequence
MAQPRYDDGLHGYGMDSGAAAAAMYDPHAGHRPPGLQGLPSHHSPHMTHAAAAAATVGMHGYHSGAGGHGTPSHVSPVGNHLMGAIPEVHKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYMMDSQAHMMHRPPGDPGFHQGYPHYPPAEYYGQHL
Sequence Length
487
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,657 Da
NCBI Official Full Name
homothorax, isoform E
NCBI Official Synonym Full Names
homothorax
NCBI Official Symbol
hth
NCBI Official Synonym Symbols
1323/07; 1422/04; anon-EST:Liang-2.13; CG17117; clone 2.13; Dm-HTH; DmelCG17117; dtl; Hth; HTH; hth1; hth2; l(3)05745; l(3)86Ca; Meis1; P53
NCBI Protein Information
CG17117 gene product from transcript CG17117-RC
UniProt Protein Name
Homeobox protein homothorax
Protein Family
UniProt Gene Name
hth
Uniprot Description
All isoforms are required for patterning of the embryonic cuticle. Acts with exd to delimit the eye field and prevent inappropriate eye development. Isoforms that carry the homeodomain are required for proper localization of chordotonal organs within the peripheral nervous system and antennal identity; required to activate antennal-specific genes, such as sal and to repress the leg-like expression of dac. Necessary for the nuclear localization of the essential HOX cofactor, extradenticle (exd). Both necessary and sufficient for inner photoreceptors to adopt the polarization-sensitive 'dorsal rim area' (DRA) of the eye fate instead of the color-sensitive default state. This occurs by increasing rhabdomere size and uncoupling R7-R8 communication to allow both cells to express the same opsin rather than different ones as required for color vision.
Research Articles on hth
Similar Products
Product Notes
The hth hth (Catalog #AAA1020019) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-487, Full length protein. The amino acid sequence is listed below: MAQPRYDDGL HGYGMDSGAA AAAMYDPHAG HRPPGLQGLP SHHSPHMTHA AAAAATVGMH GYHSGAGGHG TPSHVSPVGN HLMGAIPEVH KRDKDAIYEH PLFPLLALIF EKCELATCTP REPGVQGGDV CSSESFNEDI AMFSKQIRSQ KPYYTADPEV DSLMVQAIQV LRFHLLELEK VHELCDNFCH RYISCLKGKM PIDLVIDERD TTKPPELGSA NGEGRSNADS TSHTDGASTP DVRPPSSSLS YGGAMNDDAR SPGAGSTPGP LSQQPPALDT SDPDGKFLSS LNPSELTYDG RWCRREWSSP ADARNADASR RLYSSVFLGS PDNFGTSASG DASNASIGSG EGTGEEDDDA SGKKNQKKRG IFPKVATNIL RAWLFQHLTH PYPSEDQKKQ LAQDTGLTIL QVNNWFINAR RRIVQPMIDQ SNRAVYTPHP GPSGYGHDAM GYMMDSQAHM MHRPPGDPGF HQGYPHYPPA EYYGQHL. It is sometimes possible for the material contained within the vial of "Homeobox protein homothorax (hth), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
