Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B) Recombinant Protein | HSD3B1 recombinant protein

Recombinant Horse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

Gene Names
HSD3B1; HSD3B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B); Recombinant Horse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B); Recombinant 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B); 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 3-beta-HSD Including the following 2 domains: 3-beta-hydroxy-Delta(5)-steroid dehydrogenase EC= 1.1.1.145; 3-beta-hyd; HSD3B1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-373
Sequence
AGWSCLVTGAGGFLGQRIVRLLVEEKEVQEIRALDKVFRPELREEFSKLQSKVKLTVLEGDILDEQFLKRACQGASAVIHTASIIDVTNLFNPQVTMNVNVEGTQLLLEACSQASVPIFIYTSSVAVAGPNSYREIIQNGHEEAHLETKWSSPYPYSKKLAEKAVLAANGLPLKNGGTLYTCALRPMFIYGEGSPTLYYLMHEGLNNNGILTHNCKFSRANPVYVGNIAWAHIMALRALRDPKKAPSIQGQFYYISDDTPPQSYDDLTYTLSKKWGFCLDSRMRLPIFLKYWLAFLLEIVSFLLSPIYKYRPPFDRHLVTWQNSVFTFSYKKAQRDMGYEPLFSWEEAKKRTTEWIDALVEPHQEALKTKTL
Sequence Length
373
Species
Equus caballus (Horse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,411 Da
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase
NCBI Official Symbol
HSD3B1
NCBI Official Synonym Symbols
HSD3B
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 3-beta-HSD
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase
UniProt Gene Name
HSD3B
UniProt Synonym Gene Names
3-beta-HSD
UniProt Entry Name
3BHS_HORSE

Uniprot Description

Function: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Catalytic activity: A 3-beta-hydroxy-Delta(5)-steroid + NAD+ = a 3-oxo-Delta(5)-steroid + NADH.A 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.

Pathway: Lipid metabolism; steroid biosynthesis.

Subcellular location: Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Sequence similarities: Belongs to the 3-beta-HSD family.

Similar Products

Product Notes

The HSD3B1 hsd3b (Catalog #AAA1014522) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-373. The amino acid sequence is listed below: AGWSCLVTGA GGFLGQRIVR LLVEEKEVQE IRALDKVFRP ELREEFSKLQ SKVKLTVLEG DILDEQFLKR ACQGASAVIH TASIIDVTNL FNPQVTMNVN VEGTQLLLEA CSQASVPIFI YTSSVAVAGP NSYREIIQNG HEEAHLETKW SSPYPYSKKL AEKAVLAANG LPLKNGGTLY TCALRPMFIY GEGSPTLYYL MHEGLNNNGI LTHNCKFSRA NPVYVGNIAW AHIMALRALR DPKKAPSIQG QFYYISDDTP PQSYDDLTYT LSKKWGFCLD SRMRLPIFLK YWLAFLLEIV SFLLSPIYKY RPPFDRHLVT WQNSVFTFSY KKAQRDMGYE PLFSWEEAKK RTTEWIDALV EPHQEALKTK TL. It is sometimes possible for the material contained within the vial of "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.