3-keto-steroid reductase Recombinant Protein | Hsd17b7 recombinant protein
3-keto-steroid reductase
Gene Names
Hsd17b7; ERG27; AI266814
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-keto-steroid reductase; Hsd17b7 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-334aa; full length protein
Sequence
MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Hsd17b7 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Hsd17b7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,317 Da
NCBI Official Full Name
3-keto-steroid reductase
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 7
NCBI Official Symbol
Hsd17b7
NCBI Official Synonym Symbols
ERG27; AI266814
NCBI Protein Information
3-keto-steroid reductase
UniProt Protein Name
3-keto-steroid reductase
Protein Family
UniProt Gene Name
Hsd17b7
UniProt Synonym Gene Names
17-beta-HSD 7
UniProt Entry Name
DHB7_MOUSE
Uniprot Description
HSD17B7: Responsible for the reduction of the keto group on the C-3 of sterols. Belongs to the short-chain dehydrogenases/reductases (SDR) family. ERG27 subfamily. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Lipid Metabolism - steroid biosynthesis; Lipid Metabolism - androgen and estrogen; EC 1.1.1.270; Oxidoreductase; Membrane protein, integral; Endoplasmic reticulum; EC 1.1.1.62
Cellular Component: endoplasmic reticulum; membrane
Molecular Function: 3-keto sterol reductase activity; prolactin receptor binding
Biological Process: cholesterol biosynthetic process
Research Articles on Hsd17b7
Similar Products
Product Notes
The Hsd17b7 hsd17b7 (Catalog #AAA7042866) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-334aa; full length protein. The amino acid sequence is listed below: MRKVVLITGA SSGIGLALCG RLLAEDDDLH LCLACRNLSK ARAVRDTLLA SHPSAEVSIV QMDVSSLQSV VRGAEEVKQK FQRLDYLYLN AGILPNPQFN LKAFFCGIFS RNVIHMFTTA EGILTQNDSV TADGLQEVFE TNLFGHFILI RELEPLLCHA DNPSQLIWTS SRNAKKANFS LEDIQHSKGP EPYSSSKYAT DLLNVALNRN FNQKGLYSSV MCPGVVMTNM TYGILPPFIW TLLLPIMWLL RFFVNALTVT PYNGAEALVW LFHQKPESLN PLTKYASATS GFGTNYVTGQ KMDIDEDTAE KFYEVLLELE KRVRTTVQKS DHPS. It is sometimes possible for the material contained within the vial of "3-keto-steroid reductase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
