Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

17-beta-hydroxysteroid dehydrogenase type 6 (HSD17B6) Recombinant Protein | HSD17B6 recombinant protein

Recombinant Human 17-beta-hydroxysteroid dehydrogenase type 6 (HSD17B6)

Gene Names
HSD17B6; HSE; RODH; SDR9C6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
17-beta-hydroxysteroid dehydrogenase type 6 (HSD17B6); Recombinant Human 17-beta-hydroxysteroid dehydrogenase type 6 (HSD17B6); HSD17B6 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-317. Full Length of Mature Protein
Sequence
YRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HSD17B6 recombinant protein
This protein has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,966 Da
NCBI Official Full Name
17-beta-hydroxysteroid dehydrogenase type 6
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 6
NCBI Official Symbol
HSD17B6
NCBI Official Synonym Symbols
HSE; RODH; SDR9C6
NCBI Protein Information
17-beta-hydroxysteroid dehydrogenase type 6
UniProt Protein Name
17-beta-hydroxysteroid dehydrogenase type 6
UniProt Gene Name
HSD17B6
UniProt Synonym Gene Names
RODH; SDR9C6; 17-beta-HSD 6; 17-beta-HSD6; 3-alpha->beta-HSE

NCBI Description

The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. [provided by RefSeq, Aug 2013]

Uniprot Description

NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3-alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha-androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids.

Research Articles on HSD17B6

Similar Products

Product Notes

The HSD17B6 hsd17b6 (Catalog #AAA1173484) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-317. Full Length of Mature Protein. The amino acid sequence is listed below: YRERQVVSHL QDKYVFITGC DSGFGNLLAR QLDARGLRVL AACLTEKGAE QLRGQTSDRL ETVTLDVTKM ESIAAATQWV KEHVGDRGLW GLVNNAGILT PITLCEWLNT EDSMNMLKVN LIGVIQVTLS MLPLVRRARG RIVNVSSILG RVAFFVGGYC VKYGVEAFSD ILRREIQHFG VKISIVEPGY FRTGMTNMTQ SLERMKQSWK EAPKHIKETY GQQYFDALYN IMKEGLLNCS TNLNLVTDCM EHALTSVHPR TRYSAGWDAK FFFIPLSYLP TSLADYILTR SWPKPAQAV . It is sometimes possible for the material contained within the vial of "17-beta-hydroxysteroid dehydrogenase type 6 (HSD17B6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.