Activator of apoptosis harakiri (Hrk) Recombinant Protein | Hrk recombinant protein
Recombinant Rat Activator of apoptosis harakiri (Hrk)
Gene Names
Hrk; Dp5; Bid3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Activator of apoptosis harakiri (Hrk); Recombinant Rat Activator of apoptosis harakiri (Hrk); Recombinant Activator of apoptosis harakiri (Hrk); Activator of apoptosis harakiri; BH3-interacting domain-containing protein 3 Neuronal death protein DP5; Hrk recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-92
Sequence
MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVAALAAWLLGRRSA
Sequence Length
92
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,078 Da
NCBI Official Full Name
activator of apoptosis harakiri
NCBI Official Synonym Full Names
harakiri, BCL2 interacting protein (contains only BH3 domain)
NCBI Official Symbol
Hrk
NCBI Official Synonym Symbols
Dp5; Bid3
NCBI Protein Information
activator of apoptosis harakiri; BH3 interacting domain 3; neuronal death protein DP5; BH3-interacting domain-containing protein 3; BH3 interacting (with BCL2 family) domain, apoptosis agonist
UniProt Protein Name
Activator of apoptosis harakiri
Protein Family
UniProt Gene Name
Hrk
UniProt Synonym Gene Names
Bid3; Dp5
UniProt Entry Name
HRK_RAT
NCBI Description
member of the Bcl-2 family of proteins; has a role in programmed neuronal death [RGD, Feb 2006]
Uniprot Description
HRK: Promotes apoptosis.
Protein type: Apoptosis; Membrane protein, integral
Cellular Component: mitochondrion; integral to membrane
Molecular Function: protein binding
Biological Process: cellular response to potassium ion starvation; positive regulation of protein homooligomerization; apoptosis; positive regulation of apoptosis; positive regulation of neuron apoptosis
Research Articles on Hrk
Similar Products
Product Notes
The Hrk hrk (Catalog #AAA951135) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-92. The amino acid sequence is listed below: MCPCPRHRGR GPPAVCGCGD ARPGLRWAAA QVTALRLQAL GDELHRRAMR RRARPRDPLP ALLPALRARW PWLCAAAQVA ALAAWLLGRR SA. It is sometimes possible for the material contained within the vial of "Activator of apoptosis harakiri (Hrk), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
