SDS-PAGE
GTPase Hras Recombinant Protein | Hras recombinant protein
Recombinant Rat GTPase HRas protein
Gene Names
Hras; HRAS1; c-H-ras
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GTPase Hras; Recombinant Rat GTPase HRas protein; H-Ras-1; Transforming protein p21c-H-rasp; 21ras; Hras recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-186aa; Full Length
Sequence
TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Sequence Length
189
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Hras recombinant protein
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
References
Nucleotide sequence of the two rat cellular rasH genes.Ruta M., Wolford R., Dhar R., Defeo-Jones D., Ellis R.W., Scolnick E.M.Mol. Cell. Biol. 6:1706-1710(1986)
Nucleotide sequence and characterization of the 5' flanking region of the rat Ha-ras protooncogene.Damante G., Filetti S., Rapoport B.Proc. Natl. Acad. Sci. U.S.A. 84:774-778(1987)
Posttranslational modification of the Ha-ras oncogene protein
evidence for a third class of protein carboxyl methyltransferases.Clarke S., Vogel J.P., Deschenes R.J., Stock J.Proc. Natl. Acad. Sci. U.S.A. 85:4643-4647(1988)
Phospholipase C(epsilon)
a novel Ras effector.Kelley G.G., Reks S.E., Ondrako J.M., Smrcka A.V.EMBO J. 20:743-754(2001)
Regulator of G-protein signaling 14 (RGS14)
is a selective H-Ras effector.Willard F.S., Willard M.D., Kimple A.J., Soundararajan M., Oestreich E.A., Li X., Sowa N.A., Kimple R.J., Doyle D.A., Der C.J., Zylka M.J., Snider W.D., Siderovski D.P.PLoS ONE 4:E4884-E4884(2009)
RGS14 is a multifunctional scaffold that integrates G protein and Ras/Raf MAPkinase signalling pathways.Shu F.J., Ramineni S., Hepler J.R.Cell. Signal. 22:366-376(2010)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24.9 kDa
NCBI Official Full Name
GTPase HRas
NCBI Official Synonym Full Names
Harvey rat sarcoma virus oncogene
NCBI Official Symbol
Hras
NCBI Official Synonym Symbols
HRAS1; c-H-ras
NCBI Protein Information
GTPase HRas
UniProt Protein Name
GTPase HRas
Protein Family
UniProt Gene Name
Hras
UniProt Synonym Gene Names
Hras1
UniProt Entry Name
RASH_RAT
NCBI Description
mutated in rats exposed to the carcinogen 2-amino-1-methyl-6phenylimidazo[4;5-b]pyridine (PhiP); may be involved in the pathogenesis of chemically induced mammary tumors [RGD, Feb 2006]
Uniprot Description
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Research Articles on Hras
Similar Products
Product Notes
The Hras hras (Catalog #AAA1265572) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-186aa; Full Length. The amino acid sequence is listed below: TEYKLVVVGA GGVGKSALTI QLIQNHFVDE YDPTIEDSYR KQVVIDGETC LLDILDTAGQ EEYSAMRDQY MRTGEGFLCV FAINNTKSFE DIHQYREQIK RVKDSDDVPM VLVGNKCDLA ARTVESRQAQ DLARSYGIPY IETSAKTRQG VEDAFYTLVR EIRQHKLRKL NPPDESGPGC MSCKC. It is sometimes possible for the material contained within the vial of "GTPase Hras, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
