Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Homeobox protein Hox-D4 (HOXD4) Recombinant Protein | HOXD4 recombinant protein

Recombinant Chicken Homeobox protein Hox-D4 (HOXD4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Homeobox protein Hox-D4 (HOXD4); Recombinant Chicken Homeobox protein Hox-D4 (HOXD4); HOXD4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-235, Full length protein
Sequence
MAMSSYMVNSYVDPKFPPCEEYLQSSYLGEQGAEYYGASQGSDFQHQGLYPRSNYSEQPFWLAGAQGSAVQPRGHGQEQSAPPSHFPGQAEHCPPPPCPIPSCGQQPALKAPHGSAVKQPAVVYPWMKKVHVNSVNPNYSGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSASNPHLQTVPKDHQTDLTTL
Sequence Length
235
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HOXD4 recombinant protein
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5 end of this cluster have been associated with severe limb and genital abnormalities. This protein may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
26,662 Da
NCBI Official Full Name
Homeobox protein Hox-D4
UniProt Protein Name
Homeobox protein Hox-D4
Protein Family
UniProt Gene Name
HOXD4
UniProt Synonym Gene Names
CHOX-A; HOXD-4; Chox-A

Uniprot Description

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to sites in the 5'-flanking sequence of its coding region with various affinities. The consensus sequences of the high and low affinity binding sites are 5'-TAATGA[CG]-3' and 5'-CTAATTTT-3'.

Similar Products

Product Notes

The HOXD4 hoxd4 (Catalog #AAA962774) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-235, Full length protein. The amino acid sequence is listed below: MAMSSYMVNS YVDPKFPPCE EYLQSSYLGE QGAEYYGASQ GSDFQHQGLY PRSNYSEQPF WLAGAQGSAV QPRGHGQEQS APPSHFPGQA EHCPPPPCPI PSCGQQPALK APHGSAVKQP AVVYPWMKKV HVNSVNPNYS GGEPKRSRTA YTRQQVLELE KEFHFNRYLT RRRRIEIAHT LCLSERQIKI WFQNRRMKWK KDHKLPNTKG RSSSSASNPH LQTVPKDHQT DLTTL. It is sometimes possible for the material contained within the vial of "Homeobox protein Hox-D4 (HOXD4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.