Heterogeneous nuclear ribonucleoprotein H Recombinant Protein | HNRPH1 recombinant protein

Recombinant Human Heterogeneous nuclear ribonucleoprotein H

Cat. Num. AAA717264

• Gene Names: HNRNPH1; HNRPH; HNRPH1; hnRNPH
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Heterogeneous nuclear ribonucleoprotein H; Recombinant Human Heterogeneous nuclear ribonucleoprotein H; HNRPH1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-216aa; Partial
• Sequence: MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG
• Sequence Length: 449

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for HNRPH1 recombinant protein

This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).

Product Categories/Family for HNRPH1 recombinant protein

Transcription

References

Heterogeneous nuclear ribonucleoproteins H, H', and F are members of a ubiquitously expressed subfamily of related but distinct proteins encoded by genes mapping to different chromosomes.Honore B., Rasmussen H.H., Vorum H., Dejgaard K., Liu X., Gromov P., Madsen P., Gesser B., Tommerup N., Celis J.E.J. Biol. Chem. 270:28780-28789(1995)

NCBI and Uniprot Product Information

• NCBI GI #: 381342476
• NCBI GeneID: 3187
• NCBI Accession #: NP_001244222.1
• NCBI GenBank Nucleotide #: NM_001257293.1
• UniProt Accession #: P31943; Q6IBM4; B3KW86; D3DWQ2
• Molecular Weight: 51.2 kDa
• NCBI Official Full Name: heterogeneous nuclear ribonucleoprotein H
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein H1 (H)
• NCBI Official Symbol: HNRNPH1
• NCBI Official Synonym Symbols: HNRPH; HNRPH1; hnRNPH
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein H
• UniProt Protein Name: Heterogeneous nuclear ribonucleoprotein H
• Protein Family: Heterogeneous nuclear ribonucleoprotein
• UniProt Gene Name: HNRNPH1
• UniProt Synonym Gene Names: HNRPH; HNRPH1; hnRNP H
• UniProt Entry Name: HNRH1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some may shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNA and is very similar to the family member HNRPF. This gene may be associated with hereditary lymphedema type I. Alternatively spliced transcript variants have been described [provided by RefSeq, Mar 2012]

Uniprot Description

hnRNP H1: This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).

Protein type: RNA-binding; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: cytoplasm; membrane; nucleoplasm; nucleus

Molecular Function: nucleotide binding; poly(U) binding; protein binding; RNA binding

Biological Process: gene expression; nuclear mRNA splicing, via spliceosome; regulation of RNA splicing; RNA processing; RNA splicing