Biotin--protein ligase (Hlcs) Recombinant Protein | Hlcs recombinant protein
Recombinant Mouse Biotin--protein ligase (Hlcs)
Gene Names
Hlcs; D16Jhu34; 410I21.SP6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Biotin--protein ligase (Hlcs); Recombinant Mouse Biotin--protein ligase (Hlcs); Hlcs recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-722, Full length protein
Sequence
MEDRLQMDNGLIAQKIVSVHLKDPALKELGKASDKQVQGPPPGPEASPEAQPAQGVMEHAGQGDCKAAGEGPSPRRRGCAPESEPAADGDPGLSSPELCQLHLSICHECLELENSTIDSVRSASAENIPDLPCDHSGVEGAAGELCPERKGKRVNISGKAPNILLYVGSGSEEALGRLQQVRSVLTDCVDTDSYTLYHLLEDSALRDPWSDNCLLLVIASRDPIPKDIQHKFMAYLSQGGKVLGLSSPFTLGGFRVTRRDVLRNTVQNLVFSKADGTEVRLSVLSSGYVYEEGPSLGRLQGHLENEDKDKMIVHVPFGTLGGEAVLCQVHLELPPGASLVQTADDFNVLKSSNVRRHEVLKEILTALGLSCDAPQVPALTPLYLLLAAEETQDPFMQWLGRHTDPEGIIKSSKLSLQFVSSYTSEAEITPSSMPVVTDPEAFSSEHFSLETYRQNLQTTRLGKVILFAEVTSTTMSLLDGLMFEMPQEMGLIAIAVRQTQGKGRGPNAWLSPVGCALSTLLVFIPLRSQLGQRIPFVQHLMSLAVVEAVRSIPGYEDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLIEEHNKQHGAGLKPLRADCLIARAVTVLEKLIDRFQDQGPDGVLPLYYKYWVHGGQQVRLGSTEGPQASIVGLDDSGFLQVHQEDGGVVTVHPDGNSFDMLRNLIVPKRQ
Sequence Length
722
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,516 Da
NCBI Official Full Name
biotin--protein ligase isoform 2
NCBI Official Synonym Full Names
holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase)
NCBI Official Symbol
Hlcs
NCBI Official Synonym Symbols
D16Jhu34; 410I21.SP6
NCBI Protein Information
biotin--protein ligase
UniProt Protein Name
Biotin--protein ligase
Protein Family
UniProt Gene Name
Hlcs
UniProt Synonym Gene Names
HCS
Uniprot Description
Post-translational modification of specific protein by attachment of biotin. Acts on various carboxylases such as acetyl-CoA-carboxylase, pyruvate carboxylase, propionyl CoA carboxylase, and 3-methylcrotonyl CoA carboxylase ().
Similar Products
Product Notes
The Hlcs hlcs (Catalog #AAA1339506) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-722, Full length protein. The amino acid sequence is listed below: MEDRLQMDNG LIAQKIVSVH LKDPALKELG KASDKQVQGP PPGPEASPEA QPAQGVMEHA GQGDCKAAGE GPSPRRRGCA PESEPAADGD PGLSSPELCQ LHLSICHECL ELENSTIDSV RSASAENIPD LPCDHSGVEG AAGELCPERK GKRVNISGKA PNILLYVGSG SEEALGRLQQ VRSVLTDCVD TDSYTLYHLL EDSALRDPWS DNCLLLVIAS RDPIPKDIQH KFMAYLSQGG KVLGLSSPFT LGGFRVTRRD VLRNTVQNLV FSKADGTEVR LSVLSSGYVY EEGPSLGRLQ GHLENEDKDK MIVHVPFGTL GGEAVLCQVH LELPPGASLV QTADDFNVLK SSNVRRHEVL KEILTALGLS CDAPQVPALT PLYLLLAAEE TQDPFMQWLG RHTDPEGIIK SSKLSLQFVS SYTSEAEITP SSMPVVTDPE AFSSEHFSLE TYRQNLQTTR LGKVILFAEV TSTTMSLLDG LMFEMPQEMG LIAIAVRQTQ GKGRGPNAWL SPVGCALSTL LVFIPLRSQL GQRIPFVQHL MSLAVVEAVR SIPGYEDINL RVKWPNDIYY SDLMKIGGVL VNSTLMGETF YILIGCGFNV TNSNPTICIN DLIEEHNKQH GAGLKPLRAD CLIARAVTVL EKLIDRFQDQ GPDGVLPLYY KYWVHGGQQV RLGSTEGPQA SIVGLDDSGF LQVHQEDGGV VTVHPDGNSF DMLRNLIVPK RQ. It is sometimes possible for the material contained within the vial of "Biotin--protein ligase (Hlcs), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
