HLA class II histocompatibility antigen, DM beta chain (HLA-DMB) Recombinant Protein | HLA-DMB recombinant protein

Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB), partial

Cat. Num. AAA1096853

• Gene Names: HLA-DMB; RING7; D6S221E
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: HLA class II histocompatibility antigen; DM beta chain (HLA-DMB); Recombinant Human HLA class II histocompatibility antigen; partial; HLA-DMB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 19-218aa, Partial
• Sequence: GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
• Sequence Length: 263

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for HLA-DMB recombinant protein

Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.

Product Categories/Family for HLA-DMB recombinant protein

Immunology

References

"Genomic organization of HLA-DMA and HLA-DMB. Comparison of the gene organization of all six class II families in the human major histocompatibility complex." Radley E., Alderton R.P., Kelly A., Trowsdale J., Beck S. J. Biol. Chem. 269:18834-18838(1994)

NCBI and Uniprot Product Information

• NCBI GI #: 301129275
• NCBI GeneID: 3109
• NCBI Accession #: NP_002109.2
• NCBI GenBank Nucleotide #: NM_002118.4
• UniProt Accession #: P28068; O77936; Q13012; Q29751; Q58ZE2; Q5SNZ8; Q5STC4; Q9XRX2
• Molecular Weight: 26.4 kDa
• NCBI Official Full Name: HLA class II histocompatibility antigen, DM beta chain
• NCBI Official Synonym Full Names: major histocompatibility complex, class II, DM beta
• NCBI Official Symbol: HLA-DMB
• NCBI Official Synonym Symbols: RING7; D6S221E
• NCBI Protein Information: HLA class II histocompatibility antigen, DM beta chain
• UniProt Protein Name: HLA class II histocompatibility antigen, DM beta chain
• Protein Family: HLA class II histocompatibility antigen
• UniProt Gene Name: HLA-DMB
• UniProt Synonym Gene Names: DMB; RING7

NCBI Description

HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008]

Uniprot Description

Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.