HLA-DMA recombinant protein

Recombinant Human HLA-DMA protein

Cat. Num. AAA1258275

• Gene Names: HLA-DMA; DMA; HLADM; RING6; D6S222E
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: HLA-DMA; Recombinant Human HLA-DMA protein; Homo sapiens (Human); HLA-DMA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 27-233aa; Partial
• Sequence: VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC
• Sequence Length: 233

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Product Categories/Family for HLA-DMA recombinant protein

Cardiovascular

References

"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004)

NCBI and Uniprot Product Information

• NCBI GI #: 18765715
• NCBI GeneID: 3108
• NCBI Accession #: NP_006111.2
• NCBI GenBank Nucleotide #: NM_006120.3
• UniProt Accession #: Q6ICR9; P28067
• Molecular Weight: 27.4 kDa
• NCBI Official Full Name: HLA class II histocompatibility antigen, DM alpha chain
• NCBI Official Synonym Full Names: major histocompatibility complex, class II, DM alpha
• NCBI Official Symbol: HLA-DMA
• NCBI Official Synonym Symbols: DMA; HLADM; RING6; D6S222E
• NCBI Protein Information: HLA class II histocompatibility antigen, DM alpha chain
• UniProt Protein Name: HLA-DMA protein
• Protein Family: HLA class II histocompatibility antigen
• UniProt Gene Name: HLA-DMA
• UniProt Entry Name: Q6ICR9_HUMAN

NCBI Description

HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. [provided by RefSeq, Jul 2008]