Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Hexokinase-1 (HK1) Recombinant Protein | HK1 recombinant protein

Recombinant Human Hexokinase-1 (HK1), partial

Gene Names
HK1; HKI; HXK1; HK1-ta; HK1-tb; HK1-tc
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hexokinase-1 (HK1); Recombinant Human Hexokinase-1 (HK1); partial; Brain form hexokinaseHexokinase type I ; HK I; HK1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
476-917aa, Partial
Sequence
HFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
Species
Homo sapiens (Human)
Subcellular Location
Mitochondrion outer membrane
Protein Families
Hexokinase family
Tissue Specificity
Isoform 2 is erythrocyte specific. Isoform 3 and isoform 4 are testis-specific.
Pathway
HIF-1 signaling pathway
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for HK1 recombinant protein
References
The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004)
https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:4922
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=370365
https://www.genome.jp/dbget-bin/www_bget?hsa:3098
https://string-db.org/network/9606.ENSP00000384774
https://www.omim.org/entry/142600142600142600

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102,486 Da
NCBI Official Full Name
hexokinase-1 isoform HKI
NCBI Official Synonym Full Names
hexokinase 1
NCBI Official Symbol
HK1
NCBI Official Synonym Symbols
HKI; HXK1; HK1-ta; HK1-tb; HK1-tc
NCBI Protein Information
hexokinase-1; HK I; glycolytic enzyme; hexokinase type I; brain form hexokinase
UniProt Protein Name
Hexokinase-1
Protein Family
UniProt Gene Name
HK1
UniProt Synonym Gene Names
HK I
UniProt Entry Name
HXK1_HUMAN

NCBI Description

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein. [provided by RefSeq, Apr 2009]

Uniprot Description

HK1: a glycolytic enzyme that catalyzes the reaction ATP + D-hexose = ADP + D-hexose 6-phosphate. The first and rate-limiting step in glycosis, a pathway that produces energy in the form of ATP from glucose. An allosteric enzyme inhibited by its product glucose-6-phosphate (Glc-6-P). HK-2 and its mitochondrial receptor (VDAC) play the most pivotal and direct roles in the ""Warburg effect"". Acts as a ""glucose sensor"" by trapping glucose inside the cell by catalyzing its phosphorylation to produce Glc-6-P. In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III and IV (glucokinase). Four human isoforms are produced by alternative splicing and alternative initiation. Isoform HK1 is markedly elevated in rapidly growing tumor cells exhibiting high glucose catabolic rates. HK1 is present in most tissues but is especially prominent in brain and kidney. Isoform HK1-SC is is an integral membrane protein detected in round spermatids, condensing spermatids and mature sperm where it is found in the head membranes, mitochondria of the midpiece and the fibrous sheath of the flagellum. Isoform HK1-SA is first expressed during meiosis and continues to be present in postmeiotic germ cells while isoform HK1-SB is present only in postmeiotic germ cells.

Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; Kinase, other; Carbohydrate Metabolism - starch and sucrose; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Mitochondrial; Carbohydrate Metabolism - galactose; EC 2.7.1.1; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 10q22

Cellular Component: mitochondrial outer membrane; mitochondrion; cytosol; lipid raft

Molecular Function: hexokinase activity; protein binding; mannokinase activity; fructokinase activity; glucokinase activity; ATP binding

Biological Process: hexose metabolic process; glycolysis; hexose transport; carbohydrate metabolic process; glucose 6-phosphate metabolic process; carbohydrate phosphorylation; cell glucose homeostasis; pathogenesis; glucose transport; transmembrane transport

Disease: Hemolytic Anemia, Nonspherocytic, Due To Hexokinase Deficiency; Neuropathy, Hereditary Motor And Sensory, Russe Type

Research Articles on HK1

Similar Products

Product Notes

The HK1 hk1 (Catalog #AAA969538) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 476-917aa, Partial. The amino acid sequence is listed below: HFHLTKDMLL EVKKRMRAEM ELGLRKQTHN NAVVKMLPSF VRRTPDGTEN GDFLALDLGG TNFRVLLVKI RSGKKRTVEM HNKIYAIPIE IMQGTGEELF DHIVSCISDF LDYMGIKGPR MPLGFTFSFP CQQTSLDAGI LITWTKGFKA TDCVGHDVVT LLRDAIKRRE EFDLDVVAVV NDTVGTMMTC AYEEPTCEVG LIVGTGSNAC YMEEMKNVEM VEGDQGQMCI NMEWGAFGDN GCLDDIRTHY DRLVDEYSLN AGKQRYEKMI SGMYLGEIVR NILIDFTKKG FLFRGQISET LKTRGIFETK FLSQIESDRL ALLQVRAILQ QLGLNSTCDD SILVKTVCGV VSRRAAQLCG AGMAAVVDKI RENRGLDRLN VTVGVDGTLY KLHPHFSRIM HQTVKELSPK CNVSFLLSED GSGKGAALIT AVGVRLRTEA SS. It is sometimes possible for the material contained within the vial of "Hexokinase-1 (HK1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.