Histidine-binding periplasmic protein (hisJ) Recombinant Protein | hisJ recombinant protein
Recombinant Escherichia coli Histidine-binding periplasmic protein (hisJ)
Gene Names
hisJ; ECK2303; JW2306
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histidine-binding periplasmic protein (hisJ); Recombinant Escherichia coli Histidine-binding periplasmic protein (hisJ); hisJ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-260, full length protein
Sequence
AIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG
Sequence Length
238
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,483 Da
NCBI Official Full Name
histidine ABC transporter periplasmic binding protein
NCBI Official Symbol
hisJ
NCBI Official Synonym Symbols
ECK2303; JW2306
NCBI Protein Information
histidine ABC transporter periplasmic binding protein
UniProt Protein Name
Histidine-binding periplasmic protein
Protein Family
UniProt Gene Name
hisJ
UniProt Synonym Gene Names
HBP
NCBI Description
Overexpression causes abnormal biofilm architecture. [More information is available at EcoGene: EG12124]. HisPMQJ is an ATP-dependent histidine transport system that is a member of the ATP-Binding Cassette (ABC) Superfamily of transporters . [More information is available at EcoCyc: EG12124].
Uniprot Description
Part of the histidine permease ABC transporter. Binds histidine. Interacts with HisQMP and stimulates ATPase activity of HisP, which results in histidine translocation ().
Research Articles on hisJ
Similar Products
Product Notes
The hisJ hisj (Catalog #AAA1213387) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-260, full length protein. The amino acid sequence is listed below: AIPQNIRIGT DPTYAPFESK NSQGELVGFD IDLAKELCKR INTQCTFVEN PLDALIPSLK AKKIDAIMSS LSITEKRQQE IAFTDKLYAA DSRLVVAKNS DIQPTVESLK GKRVGVLQGT TQETFGNEHW APKGIEIVSY QGQDNIYSDL TAGRIDAAFQ DEVAASEGFL KQPVGKDYKF GGPSVKDEKL FGVGTGMGLR KEDNELREAL NKAFAEMRAD GTYEKLAKKY FDFDVYGG. It is sometimes possible for the material contained within the vial of "Histidine-binding periplasmic protein (hisJ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
