Hypoxia-inducible factor 1-alpha inhibitor (Hif1an) Recombinant Protein | Hif1an recombinant protein
Recombinant Mouse Hypoxia-inducible factor 1-alpha inhibitor (Hif1an)
Gene Names
Hif1an; FIH; FIH1; 2310046M24Rik; A830014H24Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hypoxia-inducible factor 1-alpha inhibitor (Hif1an); Recombinant Mouse Hypoxia-inducible factor 1-alpha inhibitor (Hif1an); Hif1an recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-349, full length protein
Sequence
AATAAEVAASGSGEAREEAEAPGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMGNFQNFKPRSNREEIKFHEFVEKLQAIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGHKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFRNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Sequence Length
348
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,424 Da
NCBI Official Full Name
hypoxia-inducible factor 1-alpha inhibitor
NCBI Official Synonym Full Names
hypoxia-inducible factor 1, alpha subunit inhibitor
NCBI Official Symbol
Hif1an
NCBI Official Synonym Symbols
FIH; FIH1; 2310046M24Rik; A830014H24Rik
NCBI Protein Information
hypoxia-inducible factor 1-alpha inhibitor
UniProt Protein Name
Hypoxia-inducible factor 1-alpha inhibitor
Protein Family
UniProt Gene Name
Hif1an
Uniprot Description
Hydroxylates HIF-1 alpha at 'Asn-799' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation (). Positively regulates ASB4 activity, promoting vascular differentiation.
Research Articles on Hif1an
1. FIH-1 has a role in disrupting the LRRK1/EGFR complex to positively regulate keratinocyte migration
Similar Products
Product Notes
The Hif1an hif1an (Catalog #AAA1398467) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-349, full length protein. The amino acid sequence is listed below: AATAAEVAAS GSGEAREEAE APGPAWDESQ LRSYSFPTRP IPRLSQSDPR AEELIENEEP VVLTDTNLVY PALKWDLEYL QENIGNGDFS VYSASTHKFL YYDEKKMGNF QNFKPRSNRE EIKFHEFVEK LQAIQQRGGE ERLYLQQTLN DTVGRKIVMD FLGFNWNWIN KQQGKRGWGQ LTSNLLLIGM EGNVTPAHYD EQQNFFAQIK GHKRCILFPP DQFECLYPYP VHHPCDRQSQ VDFDNPDYER FPNFRNVVGY ETVVGPGDVL YIPMYWWHHI ESLLNGGITI TVNFWYKGAP TPKRIEYPLK AHQKVAIMRN IEKMLGEALG NPQEVGPLLN TMIKGRYN. It is sometimes possible for the material contained within the vial of "Hypoxia-inducible factor 1-alpha inhibitor (Hif1an), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
