Hepatocyte growth factor-regulated tyrosine kinase substrate (Hgs) Recombinant Protein | Hgs recombinant protein

Recombinant Rat Hepatocyte growth factor-regulated tyrosine kinase substrate (Hgs)

Cat. Num. AAA1447723

• Gene Names: Hgs; Hrs
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Hepatocyte growth factor-regulated tyrosine kinase substrate (Hgs); Recombinant Rat Hepatocyte growth factor-regulated tyrosine kinase substrate (Hgs); Hgs recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-776, full length protein
• Sequence: MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKAASTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKSTYTAHPKSEPAPLASSAPPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMVEAPLPETDSQPITSCSGPFSEQYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINSTHPQLLELLNRLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPGTFSPAGSVEGSPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPAGAPGAQAAPQAQAGPTTNPAYSSYQPTPTPGYQNVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTTLPGQDASLPAQQPYITGQQPMYQQMAPSTGPPQQQPPVAQPPPTQGPPAQGNETQLISFD
• Sequence Length: 776

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 77539444
• NCBI GeneID: 56084
• NCBI Accession #: NP_062260.2
• NCBI GenBank Nucleotide #: NM_019387.2
• UniProt Accession #: Q9JJ50; P97847; Q5XIV8; Q76N76
• Molecular Weight: 85,747 Da
• NCBI Official Full Name: hepatocyte growth factor-regulated tyrosine kinase substrate
• NCBI Official Synonym Full Names: hepatocyte growth factor-regulated tyrosine kinase substrate
• NCBI Official Symbol: Hgs
• NCBI Official Synonym Symbols: Hrs
• NCBI Protein Information: hepatocyte growth factor-regulated tyrosine kinase substrate
• UniProt Protein Name: Hepatocyte growth factor-regulated tyrosine kinase substrate
• Protein Family: Hepatocyte growth factor-regulated tyrosine kinase substrate
• UniProt Gene Name: Hgs
• UniProt Synonym Gene Names: Hrs; Hrs2

NCBI Description

interacts with SNAP-25 and is involved in regulation of neurosecretion [RGD, Feb 2006]

Uniprot Description

Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation (). May contribute to the efficient recruitment of SMADs to the activin receptor complex.