Probable E3 ubiquitin-protein ligase HERC1 (HERC1) Recombinant Protein | HERC1 recombinant protein
Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1) , partial
Gene Names
HERC1; p532; p619; MDFPMR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable E3 ubiquitin-protein ligase HERC1 (HERC1); Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1); partial; HERC1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
3975-4360. Partial
Sequence
GMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HERC1 recombinant protein
This protein stimulates guanine nucleotide exchange on ARF1 and Rab proteins. This protein is throught to be involved in membrane transport processes
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
532,228 Da
NCBI Official Full Name
probable E3 ubiquitin-protein ligase HERC1
NCBI Official Synonym Full Names
HECT and RLD domain containing E3 ubiquitin protein ligase family member 1
NCBI Official Symbol
HERC1
NCBI Official Synonym Symbols
p532; p619; MDFPMR
NCBI Protein Information
probable E3 ubiquitin-protein ligase HERC1
UniProt Protein Name
Probable E3 ubiquitin-protein ligase HERC1
Protein Family
UniProt Gene Name
HERC1
NCBI Description
This gen encodes a member of the HERC protein family. This protein stimulates guanine nucleotide exchange on ARF1 and Rab proteins. This protein may be involved in membrane transport processes. [provided by RefSeq, Mar 2012]
Uniprot Description
Involved in membrane trafficking via some guanine nucleotide exchange factor (GEF) activity and its ability to bind clathrin. Acts as a GEF for Arf and Rab, by exchanging bound GDP for free GTP. Binds phosphatidylinositol 4,5-bisphosphate, which is required for GEF activity. May also act as a E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Research Articles on HERC1
Similar Products
Product Notes
The HERC1 herc1 (Catalog #AAA1445443) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3975-4360. Partial. The amino acid sequence is listed below: GMDEQIMSWA TSRPEDWHLG GKCDVYLWGA GRHGQLAEAG RNVMVPAAAP SFSQAQQVIC GQNCTFVIQA NGTVLACGEG SYGRLGQGNS DDLHVLTVIS ALQGFVVTQL VTSCGSDGHS MALTESGEVF SWGDGDYGKL GHGNSDRQRR PRQIEALQGE EVVQMSCGFK HSAVVTSDGK LFTFGNGDYG RLGLGNTSNK KLPERVTALE GYQIGQVACG LNHTLAVSAD GSMVWAFGDG DYGKLGLGNS TAKSSPQKID VLCGIGIKKV ACGTQFSVAL TKDGHVYTFG QDRLIGLPEG RARNHNRPQQ IPVLAGVIIE DVAVGAEHTL ALASNGDVYA WGSNSEGQLG LGHTNHVREP TLVTGLQGKN VRQISAGRCH SAAWTA . It is sometimes possible for the material contained within the vial of "Probable E3 ubiquitin-protein ligase HERC1 (HERC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
